Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030505 (Prmt3)
Chromosomal location
Chr 7: 57033731 - 57112846 (+)
Description
protein arginine N-methyltransferase 3 Gene [Source:MGI (curated);Acc:Prmt3-001]
RefSeq_dna
NM_133740 
RefSeq_peptide
NP_598501.1 
MGI
MGI:1919224 
Uniprot/SWISSPROT
Q922H1 
Uniprot/SPTREMBL
Q3U2K1 Q8C1M0 Q9D8D8 
Human Ortholog
ENSG00000185238 (PRMT3)
Omim not available
UniTrap UNI5391
Vector Insertion
Chr 7: 57034084 - 57035678
Public Clones CSJ077 (baygenomics) W219E03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1835
Vector Insertion
Chr 7: 57082266 - 57084301
Public Clones BB0695 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3826
Vector Insertion
Chr 7: 57084313 - 57084401
Public Clones AX0294 (sanger) AX0293 (sanger) AX0740 (sanger) XG708 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10031
Vector Insertion
Chr 7: 57104195 - 57112736
Public Clones XC265 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032715
Sequence
GCTCTCCGGACGGTTCACGCTCCGCGTGTGGATCGCTTTGGGGGCTCCCGCGCACCCGCGCCGCTCGTTCCCGGCTCCGGTGCCGCGCTGTGCGGCCGCG

CGCTTGGTCGGCGGCCATGTGTTCGCTAGCGGCGGGGAACG GCCGTGGCGCCGAGCTGGGGCCGGAGCCCCTGGAACTGTCGGACAGCGGAGACGACGC

GGGCTGGGAGGACGAGGACGCGGACACTGAGCCCGCGCACGGCCGGCAGCACACACCCTGCCTGTTCTGTGACAG - UNI5391 - GTTGTTCGCCTC

TGCTGAGGAAACGTTTTCACACTGTAAGTTGGAGCATCAATTTAATATTGATAGTATGGTCCATAAACATG GACTTGAATTTTATGGATACATTAAACT

AATAAATTTTATTAGACTTAAG AATCCTACGGTTGAATATATGAATTCCATATATAACCCTGTGCCTTGGGAAAAAGATGAGTACCTGAAGCCAGTGTT

GGAAGATGACCTTTTGCTTCAGTTTG ATGTAGAAGATCTTTATGAGCCTGTGTCTACTCCATTCTCATACCCCAATGGACTCAGTGAAAGCGCATCTGT

TGTTGAGAAGTTGAAGCACATGGAAGCGCGGGCGCTGTCTGCTGAGGCTGCCTTGGCTCGGGCGCGTGAGGATCTGCAGAAGATGAA ACAATTTGCTCA

GGACTTTGTGATGAACGTAGATGTCAGAACCTGCTCCTCCACGACGACCATTGCAGACCTGCAGGAGGATGAGGATGGCGTCTACTTCAGCTCCTATGGG

CATTATGGGATACATGAAGAAATGCTAAAG GACAAAGTACGCACAGAAAGTTACAGAGATTTCATATACCAAAATCCACACATCTTCAAAGATAAG GT

TGTTCTGGATGTTGGGTGTGGAACTGGAATTCTCTCCATGTTTGCTGCCAAAGTTGGGGCAAAGAAAGTGATTGCAGTCGACCAGTCTGAAATCCTCTAC

CAGGCTATGGATATCATAAG ACTAAATAAACTTGAAGATACCATTGTACTAATTAAAGGAAAGATTGAAGAAGTGAGTCTTCCTGTGGAAAAGGTGGAT

GTTATTATATCAGAGTGGATG GGCTATTTTCTTCTTTTTGAGTCGATGTTGGATTCTGTCCTTTATGCTAAGAGTAAATACTTGGCAAAAGGGGGATCG

G TCTACCCTGACATTTGCACCATCAGCCTTGTAGCTGTGAGTGATGTGAGCAAGCACGCCGATAGAATTGCCTTCTGGGATGACGTCTATGGCTTCAAC

ATGTCCTGCATGAAGAAAGCAGTTATACCGGAAGCTGTTGTGGAAGTTGTGGATCACAAGACTCTTATTTCAGACCCTTGTGATATCAAG - UNI1835

 - - UNI3826 - CACATAGACTGCCACACCACGTCTATCTCAGACTTGGAGTTTTCTTCAGATTTTACCCTGAGAACCACAAAGACGGCCATGTGCA

CG - UNI3826 - GCAGTTGCTGGGTACTTTGATATATATTTTGAGAAGAATTGCCACAACAGG GTCGTGTTCTCTACTGGCCCCCAGAGCACCAAA

ACACACTGGAAACAGACAGTATTTCTGCTGGAAAAACCTTTTCCGGTTAAAGCAG - UNI10031 - GTGAAGCTCTGAAAGGAAAGATCACAGTTCA

CAAGAATAAGAAGGATCCTCGTTCCCTCATTGTGACCCTGACTTTGAACAGTTCAACCCAGACTTACAGTCTCCAGTGA
Translation
MCSLAAGNG GRGAELGPEPLELSDSGDDAGWEDEDADTEPAHGRQHTPCLFCDR - UNI5391 - RLFASAEETFSHCKLEHQFNIDSMVHKHG GL

EFYGYIKLINFIRLK NPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFD DVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARARE

DLQKMK KQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLK DKVRTESYRDFIYQNPHIFKDK VVLDVGCGTGILSMFAAKVGA

KKVIAVDQSEILYQAMDIIR RLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWM GYFLLFESMLDSVLYAKSKYLAKGGSV VYPDICTISLVAVSDV

SKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIK - UNI1835 - - UNI3826 - HIDCHTTSISDLEFSSDFTLRTTKTAMC

T - UNI3826 - AVAGYFDIYFEKNCHNR VVFSTGPQSTKTHWKQTVFLLEKPFPVKAG - UNI10031 - GEALKGKITVHKNKKDPRSLIVTL

TLNSSTQTYSLQ
Transcript ENSMUST00000085271
Sequence
GCTCTCCGGACGGTTCACGCTCCGCGTGTGGATCGCTTTGGGGGCTCCCGCGCACCCGCGCCGCTCGTTCCCGGCTCCGGTGCCGCGCTGTGCGGCCGCG

CGCTTGGTCGGCGGCCATGTGTTCGCTAGCGGCGGGGAACG GCCGTGGCGCCGAGCTGGGGCCGGAGCCCCTGGAACTGTCGGACAGCGGAGACGACGC

GGGCTGGGAGGACGAGGACGCGGACACTGAGCCCGCGCACGGCCGGCAGCACACACCCTGCCTGTTCTGTGACAG - UNI5391 - GTTGTTCGCCTC

TGCTGAGGAAACGTTTTCACACTGTAAGTTGGAGCATCAATTTAATATTGATAGTATGGTCCATAAACATG GACTTGAATTTTATGGATACATTAAACT

AATAAATTTTATTAGACTTAAG AATCCTACGGTTGAATATATGAATTCCATATATAACCCTGTGCCTTGGGAAAAAGATGAGTACCTGAAGCCAGTGTT

GGAAGATGACCTTTTGCTTCAGTTTG ATGTAGAAGATCTTTATGAGCCTGTGTCTACTCCATTCTCATACCCCAATGGACTCAGTGAAAGCGCATCTGT

TGTTGAGAAGTTGAAGCACATGGAAGCGCGGGCGCTGTCTGCTGAGGCTGCCTTGGCTCGGGCGCGTGAGGATCTGCAGAAGATGAA ACAATTTGCTCA

GGACTTTGTGATGAACGTAGATGTCAGAACCTGCTCCTCCACGACGACCATTGCAGACCTGCAGGAGGATGAGGATGGCGTCTACTTCAGCTCCTATGGG

CATTATGGGATACATGAAGAAATGCTAAAG GACAAAGTACGCACAGAAAGTTACAGAGATTTCATATACCAAAATCCACACATCTTCAAAGATAAG GT

TGTTCTGGATGTTGGGTGTGGAACTGGAATTCTCTCCATGTTTGCTGCCAAAGTTGGGGCAAAGAAAGTGATTGCAGTCGACCAGTCTGAAATCCTCTAC

CAGGCTATGGATATCATAAG ACTAAATAAACTTGAAGATACCATTGTACTAATTAAAGGAAAGATTGAAGAAGTGAGTCTTCCTGTGGAAAAGGTGGAT

GTTATTATATCAGAGTGGATG GGCTATTTTCTTCTTTTTGAGTCGATGTTGGATTCTGTCCTTTATGCTAAGAGTAAATACTTGGCAAAAGGGGGATCG

G TCTACCCTGACATTTGCACCATCAGCCTTGTAGCTGTGAGTGATGTGAGCAAGCACGCCGATAGAATTGCCTTCTGGGATGACGTCTATGGCTTCAAC

ATGTCCTGCATGAAGAAAGCAGTTATACCGGAAGCTGTTGTGGAAGTTGTGGATCACAAGACTCTTATTTCAGACCCTTGTGATATCAAG - UNI1835

 - ATGGATGGGAAGCACATAGACTGCCACACCACGTCTATCTCAGACTTGGAGTTTTCTTCAGATTTTACCCTGAGAACCACAAAGACGGCCATGTGCA

CG - UNI3826 - GCAGTTGCTGGGTACTTTGATATATATTTTGAGAAGAATTGCCACAACAGG GTCGTGTTCTCTACTGGCCCCCAGAGCACCAAA

ACACACTGGAAACAGACAGTATTTCTGCTGGAAAAACCTTTTCCGGTTAAAGCAG - UNI10031 - GTGAAGCTCTGAAAGGAAAGATCACAGTTCA

CAAGAATAAGAAGGATCCTCGTTCCCTCATTGTGACCCTGACTTTGAACAGTTCAACCCAGACTTACAGTCTCCAGTGA
Translation
MCSLAAGNG GRGAELGPEPLELSDSGDDAGWEDEDADTEPAHGRQHTPCLFCDR - UNI5391 - RLFASAEETFSHCKLEHQFNIDSMVHKHG GL

EFYGYIKLINFIRLK NPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFD DVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARARE

DLQKMK KQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLK DKVRTESYRDFIYQNPHIFKDK VVLDVGCGTGILSMFAAKVGA

KKVIAVDQSEILYQAMDIIR RLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWM GYFLLFESMLDSVLYAKSKYLAKGGSV VYPDICTISLVAVSDV

SKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIK - UNI1835 - MDGKHIDCHTTSISDLEFSSDFTLRTTKTAMCT - UNI3

826 - AVAGYFDIYFEKNCHNR VVFSTGPQSTKTHWKQTVFLLEKPFPVKAG - UNI10031 - GEALKGKITVHKNKKDPRSLIVTLTLNSSTQT

YSLQ

For any suggestions or comments, please send an email to unitrap@crg.es