Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030513 (Pcsk6)
Chromosomal location
Chr 7: 73007099 - 73195220 (+)
Description
proprotein convertase subtilisin/kexin type 6 Gene [Source:MGI Symbol;Acc:MGI:102897]
UniGene
Mm.294007 Mm.468288 
MGI
MGI:102897 
Uniprot/SPTREMBL
O35171 Q8C4U4 Q8R0Y1 Q99LE4 Q62030 Q8CFZ2 
Human Ortholog
ENSG00000140479 (PCSK6)
Omim not available
UniTrap UNI25917
Vector Insertion
Chr 7: 73007330 - 73055087
Public Clones D124B09 (ggtc) IST11524G1 (tigm) IST12836G9 (tigm) IST14927G9 (tigm)
IST14866F4 (tigm) IST14708C9 (tigm) IST11043B4 (tigm) IST11557B8 (tigm)
IST10389G2 (tigm) IST11498H1 (tigm) IST10066F5 (tigm) IST12330H12 (tigm)
IST14766E3 (tigm) IST10915F9 (tigm) IST12321E6 (tigm) IST12762H11 (tigm)
IST11444D12 (tigm) IST11609C1 (tigm) IST14223F1 (tigm) IST11502A6 (tigm)
IST12817A7 (tigm) IST11016F2 (tigm) IST10809H7 (tigm) IST11324H3 (tigm)
IST10347G5 (tigm)
Private Clones OST151551 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI386
Vector Insertion
Chr 7: 73192556 - 73193791
Public Clones GC1311 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098391
Sequence
AGAGTCAAGAGACAGGCGCGAAGTGACTCTCTTTATTTCAATGATCCCATTTGGTCTAACATGTGGTACATG CATTGTACTGATAAGAACAGTCGCTGT

CGGTCAGAGATGAACGTCCAGGCGGCGTGGAAGCGTGGCTACACAGGAAAGAATGTGGTCGTCACCATCCTCGATGACGGCATAGAAAGGAATCACCCAG

ACCTGGCCCCCAACTAC GATTCCTATGCAAGCTACGATGTCAATGGAAATGATTATGACCCATCCCCGAGATATGACGCCAGCAACGAGAACAA ACAT

GGCACTCGCTGTGCGGGTGAAGTCGCTGCCTCGGCCAACAACTCCTACTGCATCGTGGGCATCGCATATAATGCAAAGATAGGAG GCATCCGGATGCTG

GACGGCGATGTGACCGATGTGGTGGAGGCCAAGTCTCTGGGCATCAGACCCAACTACATTGACATTTACAGCGCCAGTTGGGGACCCGATGATGACGGAA

AGACAGTAGATGGACCAGGCCGGCTGGCTAAACAAGCTTTCGAGTATGGCATTAAAAAG GGTCGCCAAGGTCTGGGCTCCATTTTTGTTTGGGCCTCTG

GGAATGGTGGGAGAGAAGGGGACCACTGCTCCTGTGATGGCTACACCAACAGCATCTACACCATCTCCGTAAGCAGCACCACTGAGAACGGCCACAAACC

CTGGTACCTGGAAGAATGCGCTTCCACGTTGGCTACCACCTACAGCAGCGGGGCCTTCTATGAACGGAAGATC GTCACCACAGATCTGCGTCAGCGCTG

CACCGACGGCCACACTGGGACATCAGTCTCAGCCCCCATGGTGGCTGGTATCATTGCCTTGGCTCTAGAAGCAAA CAACCAGTTGACCTGGAGGGATGT

GCAGCACCTGCTGGTGAAGACATCACGGCCAGCTCATCTGAAGGCGAGCGACTGGAAAGTCAACGGAGCTGGGCATAAAG TTAGCCATCTCTATGGATT

TGGCTTGGTGGATGCAGAAGCTCTGGTCCTGGAGGCGAGGAAGTGGACGGCAGTGCCCTCCCAGCACGTATGCGTGGCCACCGCAGACAAAAGGCCCAG 

GAGCATCCCCATAGTGCAGGTGCTACGGACCACAGCCCTGACCAACGCCTGTGCGGACCACTCAGACCAGCGTGTGGTGTACCTGGAGCATGTGGTTGTC

CGAATCTCTATCTCACACCCACGCCGGGGCGATCTCCAGATCCACCTGATTTCTCCCTCTGGAACCAAGTCTCAACTTTTGGCAAAGAG ATTGCTGGAT

TTTTCCAATGAGGGGTTCACAAACTGGGAATTCATGACCGTCCACTGCTGGGGAGAAAAGGCTGAAGGGGAGTGGACTCTGGAAGTGCAGGATATACCAT

CGCAGGTCCGAAACCCAGAGAAACAAG GAAAGCTGAAAGAATGGAGCCTCATTTTATATGGCACCGCAGAGCACCCATATCGCACCTTCAGCTCCCATC

AGTCTCGCTCACGGATGCTGGAGCTCTCCGTCCCGGAGCAGGAGCCTCCCAAGGCTGCTGGACAACCACCCCAGGCAGAGACTCCAGAAGACGAGGAAGA

GTACACAG CTCCTTCCATCCAAGGCTCTCCTAATACTTTACAGACCA GTGTGTGCCATCCCGAGTGTGGTGACAAAGGCTGTGATGGTCCCAATGCAG

ACCAGTGCTTGAACTGTGTCCACTTCAGCCTGGGGAACTCCAAGACAAACAG GAAGTGTGTGAGCGAGTGCCCCTTGGGCTACTTTGGGGATGCAGCTG

CAAGACGCTGCCGTCGCTGCCATAAGGGATGTGAGACGTGCACGGGCAGGAGCCCAGCACAGTGCCTGTCTTGTCGCCGTGGGTTCTATCACCACCAGGA

GACGAACACGTGTGTGACCCTCTGTCCTGCCGGACTTTATGCTGATGAAA GTCAGAGACTCTGCCTCAGGTGCCACCCGAGCTGTCAGAAGTGCGTGGA

TGAACCTGAGAAGTGCACTGTGTGTAAGGAGGGATTCAG CCTGGCACGGGGCAGCTGCATTCCGGACTGTGAACCGGGTACCTACTTCGATTCAGAGCT

CGTCAAATGTGGGGAATGCCATCACACCTGCCGGACCTGTGTGG GGCCCAGCAGAGAAGAGTGTATTCACTGTGCAAAAAGCTTCCACTTCCAAGACTG

GAAATGTGTGCCGGCCTGCGGTGAGGGCTTCTACCCGGAGGAGATGCCTGGCTTACCCCACAAAGTGTGTCGAAG ATGTGAGGAGAACTGCCTGAGCTG

CGAGGGCTCCAGTAGGAACTGCAGCAGATGTAAAGCCGGCTTCACACAGCTGGGAACCTCCTGCATCACCAACCACACGTGCAGCAATG - UNI386 -

 CCGATGAGACCTTCTGCGAGATGGTGAAGTCCAATCGGCTCTGCGAACGGAAGCTCTTCATCCAGTTTTGCTGCCGCACCTGCCTCCTGGCTGGGTAGG

GGCACCAGCTGCCCGCAGAGGGCAGGGTCCTCCTGTCTGCCCGTTTGCCCATCTACCTTCCTACAGATGGTCAGCCATAGCCTGTTCCTTGGGGTAGCCC

TGCATCTGACAGCTGTATCTCCCCCAGAGCTGGGTTCTACTGCAGCATCTCTGAGCACCTGAACAGGTGGAGGTGGCCCTTAAGGATATGTGGCTAAATT

GACAAAAATCCCCTTGAACTCTGCTTGCTGGCTGCAGTCTAAAGTTGGACTCAAAACAGGAACAAAAATGAATTGTGAGACTCATACCTGCAGCTTCGGA

GTGGCTTCTGGGACCCTAGTTTACTGAGACTTCAAGACCAAAGCAGAAAAAGCGAGATGCCTGGCGTCACATCACGTCCTCCTCCCACATATCTGTGTGG

CCGTGACAAATCTCAGCGAGTCGGCTGGCAGGACCCTATGCTGCCCTCACCTATGATGAAGGGCCTCGCTTCCTCCCTGTGCATCACTGGCCACCAAACA

GCCGGAGGGACAGTTTGATCGGACTGTAAATAAAATGGGTTTCAGGGCATAAGATGTATGACCACTAGAGAGAGAATCTATGTCTACGCAGTCAGCTCCT

TCCGAAACGGCAGCCCCGGCCTGGACGGCCTAGCACCAAACCGAAATAGGTCCACTCATCCTCTCTTCAGCGTTCTCTTCTGAGTGAGCCGAGCTGTCCA

CATGGCTGTTCTACCTGTGTCCCTGGGGCCTCCTGGGCCCGAGCCACCAGCCATCTACAGCTACAGAGCCTGTGAAGGAGGATCCAAAGGAGCTACTTAG

GATTAGCCAAAAGACATCTGATGGCCAGGCAGTTCCATAAACATGCAAAGCCAGCCCCTGAATCACTAGTCGCCAGCCCTCCATGGCACACAACTGCTTT

TCAAGTGTATTTGGCCTCTGCACTCGGGACTCTCTGTTCTTGGGTGGATGCTGCGCTGGTCCAGTATGGTACAAGCCTACATGATAGAGCTGGATTGATT

TTTCTGCCAAGCCTGTGTGGGCATTTTATAAGCTACGTGTTCTAATTTTTACCGATGTTAATTATTTTGACAAATATTTCATATATTTTCATTGAAATGC

GCAAATCCGCTTGCTCAGTTCCCTGAGCTAAGGGAATAACACTTGCCTTAAATTTCCCCAACCTCGTCTCTCTCCACATGGTCCTGCTCTCCTCTCTGAC

TGTAATGTGTTTGTCTTGTCACCTGTAGGTGGCAAGGACTCAGCTGTTGTCTGTTGAATCCACACTTCAAATAAGAAATCAGTGAAGCAAATCTAATGTT

AACCCTGAGTTAATAAAAGAGTTAACATCC
Translation
           MLELSVPEQEPPKAAGQPPQAETPEDEEEYTA APSIQGSPNTLQTS SVCHPECGDKGCDGPNADQCLNCVHFSLGNSKTNR RKCVS

ECPLGYFGDAAARRCRRCHKGCETCTGRSPAQCLSCRRGFYHHQETNTCVTLCPAGLYADES SQRLCLRCHPSCQKCVDEPEKCTVCKEGFS SLARGS

CIPDCEPGTYFDSELVKCGECHHTCRTCVG GPSREECIHCAKSFHFQDWKCVPACGEGFYPEEMPGLPHKVCRR RCEENCLSCEGSSRNCSRCKAGFT

QLGTSCITNHTCSNA - UNI386 - ADETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Transcript ENSMUST00000055576
Sequence
CCCCGGGCCGCCGATGTCGCGCGGGGCGCAGGGGCCGCCGGCCGGCACGGACTCCCGCCGCTCGCGCTGCGCCCCTGGCGTTGGCTGCTTCTGCTCGCGC

TGCCCGCCGCCTGCTCCGCGCTGCCGCCGCCGCGCCCCGTCTACACCAACCACTGGGCAGTGCAAGTGCTGGGCGGCCCCGGCGCGGCGGACCGCGTGGC

TGCGGCGCACGGCTACCTCAACTTGGGCCAG - UNI25917 - ATTGGAAACCTGGACGATTACTATCATTTTTACCACAGCAAGACCTTCAAGAGAT

CGACCTTGAGCAGCAGGGGCCCCCACACCTTCCTCAGAATGGACCCACAG GTAAAATGGCTGCAACAACAGGAAGTGAAGCGCAGAGTCAAGAGACAGG

CGCGAAGTGACTCTCTTTATTTCAATGATCCCATTTGGTCTAACATGTGGTACATG CATTGTACTGATAAGAACAGTCGCTGTCGGTCAGAGATGAACG

TCCAGGCGGCGTGGAAGCGTGGCTACACAGGAAAGAATGTGGTCGTCACCATCCTCGATGACGGCATAGAAAGGAATCACCCAGACCTGGCCCCCAACTA

C GATTCCTATGCAAGCTACGATGTCAATGGAAATGATTATGACCCATCCCCGAGATATGACGCCAGCAACGAGAACAA ACATGGCACTCGCTGTGCGG

GTGAAGTCGCTGCCTCGGCCAACAACTCCTACTGCATCGTGGGCATCGCATATAATGCAAAGATAGGAG GCATCCGGATGCTGGACGGCGATGTGACCG

ATGTGGTGGAGGCCAAGTCTCTGGGCATCAGACCCAACTACATTGACATTTACAGCGCCAGTTGGGGACCCGATGATGACGGAAAGACAGTAGATGGACC

AGGCCGGCTGGCTAAACAAGCTTTCGAGTATGGCATTAAAAAG GGTCGCCAAGGTCTGGGCTCCATTTTTGTTTGGGCCTCTGGGAATGGTGGGAGAGA

AGGGGACCACTGCTCCTGTGATGGCTACACCAACAGCATCTACACCATCTCCGTAAGCAGCACCACTGAGAACGGCCACAAACCCTGGTACCTGGAAGAA

TGCGCTTCCACGTTGGCTACCACCTACAGCAGCGGGGCCTTCTATGAACGGAAGATC GTCACCACAGATCTGCGTCAGCGCTGCACCGACGGCCACACT

GGGACATCAGTCTCAGCCCCCATGGTGGCTGGTATCATTGCCTTGGCTCTAGAAGCAAA CAACCAGTTGACCTGGAGGGATGTGCAGCACCTGCTGGTG

AAGACATCACGGCCAGCTCATCTGAAGGCGAGCGACTGGAAAGTCAACGGAGCTGGGCATAAAG TTAGCCATCTCTATGGATTTGGCTTGGTGGATGCA

GAAGCTCTGGTCCTGGAGGCGAGGAAGTGGACGGCAGTGCCCTCCCAGCACGTATGCGTGGCCACCGCAGACAAAAGGCCCAG GAGCATCCCCATAGTG

CAGGTGCTACGGACCACAGCCCTGACCAACGCCTGTGCGGACCACTCAGACCAGCGTGTGGTGTACCTGGAGCATGTGGTTGTCCGAATCTCTATCTCAC

ACCCACGCCGGGGCGATCTCCAGATCCACCTGATTTCTCCCTCTGGAACCAAGTCTCAACTTTTGGCAAAGAG ATTGCTGGATTTTTCCAATGAGGGGT

TCACAAACTGGGAATTCATGACCGTCCACTGCTGGGGAGAAAAGGCTGAAGGGGAGTGGACTCTGGAAGTGCAGGATATACCATCGCAGGTCCGAAACCC

AGAGAAACAAG GAAAGCTGAAAGAATGGAGCCTCATTTTATATGGCACCGCAGAGCACCCATATCGCACCTTCAGCTCCCATCAGTCTCGCTCACGGAT

GCTGGAGCTCTCCGTCCCGGAGCAGGAGCCTCCCAAGGCTGCTGGACAACCACCCCAGGCAGAGACTCCAGAAGACGAGGAAGAGTACACAG GTGTGTG

CCATCCCGAGTGTGGTGACAAAGGCTGTGATGGTCCCAATGCAGACCAGTGCTTGAACTGTGTCCACTTCAGCCTGGGGAACTCCAAGACAAACAG GAA

GTGTGTGAGCGAGTGCCCCTTGGGCTACTTTGGGGATGCAGCTGCAAGACGCTGCCGTCGCTGCCATAAGGGATGTGAGACGTGCACGGGCAGGAGCCCA

GCACAGTGCCTGTCTTGTCGCCGTGGGTTCTATCACCACCAGGAGACGAACACGTGTGTGACCCTCTGTCCTGCCGGACTTTATGCTGATGAAA GTCAG

AGACTCTGCCTCAGGTGCCACCCGAGCTGTCAGAAGTGCGTGGATGAACCTGAGAAGTGCACTGTGTGTAAGGAGGGATTCAG CCTGGCACGGGGCAGC

TGCATTCCGGACTGTGAACCGGGTACCTACTTCGATTCAGAGCTCGTCAAATGTGGGGAATGCCATCACACCTGCCGGACCTGTGTGG GGCCCAGCAGA

GAAGAGTGTATTCACTGTGCAAAAAGCTTCCACTTCCAAGACTGGAAATGTGTGCCGGCCTGCGGTGAGGGCTTCTACCCGGAGGAGATGCCTGGCTTAC

CCCACAAAGTGTGTCGAAG ATGTGAGGAGAACTGCCTGAGCTGCGAGGGCTCCAGTAGGAACTGCAGCAGATGTAAAGCCGGCTTCACACAGCTGGGAA

CCTCCTGCATCACCAACCACACGTGCAGCAATG - UNI386 - CCGATGAGACCTTCTGCGAGATGGTGAAGTCCAATCGGCTCTGCGAACGGAAGCT

CTTCATCCAGTTTTGCTGCCGCACCTGCCTCCTGGCTGGGTAGGGGCACCAGCTGCCCGCAGAGGGCAGGGTCCTCCTGTCTGCCCGTTTGCCCATCTAC

CTTCCTACAGATGGTCAGCCATAGCCTGTTCCTTGGGGTAGCCCTGCATCTGACAGCTGTATCTCCCCCAGAGCTGGGTTCTACTGCAGCATCTCTGAGC

ACCTGAACAGGTGGAGGTGGCCCTTAAGGATATGTGGCTAAATTGACAAAAATCCCCTTGAACTCTGCTTGCTGGCTGCAGTCTAAAGTTGGACTCAAAA

CAGGAACAAAAATGAATTGTGAGACTCATACCTGCAGCTTCGGAGTGGCTTCTGGGACCCTAGTTTACTGAGACTTCAAGACCAAAGCAGAAAAAGCGAG

ATGCCTGGCGTCACATCACGTCCTCCTCCCACATATCTGTGTGGCCGTGACAAATCTCAGCGAGTCGGCTGGCAGGACCCTATGCTGCCCTCACCTATGA

TGAAGGGCCTCGCTTCCTCCCTGTGCATCACTGGCCACCAAACAGCCGGAGGGACAGTTTGATCGGACTGTAAATAAAATGGGTTTCAGGGCATAAGATG

TATGACCACTAGAGAGAGAATCTATGTCTACGCAGTCAGCTCCTTCCGAAACGGCAGCCCCGGCCTGGACGGCCTAGCACCAAACCGAAATAGGTCCACT

CATCCTCTCTTCAGCGTTCTCTTCTGAGTGAGCCGAGCTGTCCACATGGCTGTTCTACCTGTGTCCCTGGGGCCTCCTGGGCCCGAGCCACCAGCCATCT

ACAGCTACAGAGCCTGTGAAGGAGGATCCAAAGGAGCTACTTAGGATTAGCCAAAAGACATCTGATGGCCAGGCAGTTCCATAAACATGCAAAGCCAGCC

CCTGAATCACTAGTCGCCAGCCCTCCATGGCACACAACTGCTTTTCAAGTGTATTTGGCCTCTGCACTCGGGACTCTCTGTTCTTGGGTGGATGCTGCGC

TGGTCCAGTATGGTACAAGCCTACATGATAGAGCTGGATTGATTTTTCTGCCAAGCCTGTGTGGGCATTTTATAAGCTACGTGTTCTAATTTTTACCGAT

GTTAATTATTTTGACAAATATTTCATATATTTTCATTGAAATGCGCAAATCCGCTTGCTCAGTTCCCTGAGCTAAGGGAATAACACTTGCCTTAAATTTC

CCCAACCTCGTCTCTCTCCACATGGTCCTGCTCTCCTCTCTGACTGTAATGTGTTTGTCTTGTCACCTGTAGGTGGCAAGGACTCAGCTGTTGTCTGTTG

AATCCACACTTCAAATAAGAAATCAGTGAAGCAAATCTAATGTTAACCCTGAGTTAATAAAAGAGTTAACATCC
Translation
PRAADVARGAGAAGRHGLPPLALRPWRWLLLLALPAACSALPPPRPVYTNHWAVQVLGGPGAADRVAAAHGYLNLGQ - UNI25917 - IGNLDDYYH

FYHSKTFKRSTLSSRGPHTFLRMDPQ VKWLQQQEVKRRVKRQARSDSLYFNDPIWSNMWYM HCTDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGI

ERNHPDLAPNY DSYASYDVNGNDYDPSPRYDASNENK KHGTRCAGEVAASANNSYCIVGIAYNAKIGG GIRMLDGDVTDVVEAKSLGIRPNYIDIYS

ASWGPDDDGKTVDGPGRLAKQAFEYGIKK GRQGLGSIFVWASGNGGREGDHCSCDGYTNSIYTISVSSTTENGHKPWYLEECASTLATTYSSGAFYERK

I VTTDLRQRCTDGHTGTSVSAPMVAGIIALALEAN NNQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKV VSHLYGFGLVDAEALVLEARKWTAVP

SQHVCVATADKRPR RSIPIVQVLRTTALTNACADHSDQRVVYLEHVVVRISISHPRRGDLQIHLISPSGTKSQLLAKR RLLDFSNEGFTNWEFMTVHC

WGEKAEGEWTLEVQDIPSQVRNPEKQG GKLKEWSLILYGTAEHPYRTFSSHQSRSRMLELSVPEQEPPKAAGQPPQAETPEDEEEYTG GVCHPECGDK

GCDGPNADQCLNCVHFSLGNSKTNR RKCVSECPLGYFGDAAARRCRRCHKGCETCTGRSPAQCLSCRRGFYHHQETNTCVTLCPAGLYADES SQRLCL

RCHPSCQKCVDEPEKCTVCKEGFS SLARGSCIPDCEPGTYFDSELVKCGECHHTCRTCVG GPSREECIHCAKSFHFQDWKCVPACGEGFYPEEMPGLP

HKVCRR RCEENCLSCEGSSRNCSRCKAGFTQLGTSCITNHTCSNA - UNI386 - ADETFCEMVKSNRLCERKLFIQFCCRTCLLAG

For any suggestions or comments, please send an email to unitrap@crg.es