Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030539 (Sema4b)
Chromosomal location
Chr 7: 87331727 - 87371410 (+)
Description
sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B Gene [Source:MGI (curated);Acc:Sema4b-001]
RefSeq_dna
NM_013659 
RefSeq_peptide
NP_038687.2 
UniGene
Mm.275909 Mm.427382 
MGI
MGI:107559 
Uniprot/SWISSPROT
Q62179 
Uniprot/SPTREMBL
Q8BIR6 
Human Ortholog
ENSG00000185033 (SEMA4B)
Omim not available
UniTrap UNI10567
Vector Insertion
Chr 7: 87331878 - 87343404
Public Clones (sanger) P068D09 (ggtc) E068A09 (ggtc) D156D10 (ggtc) P136A07 (ggtc)
E043G06 (ggtc) D144C05 (ggtc) 5SE386A04 (ggtc) E087F02 (ggtc) D156D11 (ggtc)
P056E10 (ggtc) 5SE223H02 (ggtc) E128H05 (ggtc) D188B06 (ggtc) D128H05 (ggtc)
P010G07 (ggtc) E062G01 (ggtc) 3SE223H02 (ggtc) E119H08 (ggtc) D172H08 (ggtc)
IST14561C7 (tigm) IST13573F10 (tigm) IST12146F6 (tigm) IST13521H12 (tigm)
IST14677D6 (tigm) IST11597E12 (tigm) IST10510C1 (tigm) IST14936A2 (tigm)
IST10534C6 (tigm) IST14780H8 (tigm) IST14480C6 (tigm) IST11823F12 (tigm)
IST12158F8 (tigm) IST10939F10 (tigm) IST14515G5 (tigm) IST12142G11 (tigm)
IST10983D9 (tigm) IST12877E2 (tigm) IST10491G6 (tigm) IST13823H10 (tigm)
IST12686E11 (tigm) IST14455G2 (tigm) IST10797E12 (tigm) IST10943F4 (tigm)
IST13194H6 (tigm) IST11029E12 (tigm) IST11711D2BBF1 (tigm) IST10090H10 (tigm)
IST13995A11 (tigm) IST12432G9 (tigm) IST14413G8 (tigm) IST14047E4 (tigm)
IST11006D10 (tigm) IST14483F12 (tigm) IST10649B10 (tigm) IST11706C7 (tigm)
IST15066F7 (tigm) IST14892D7 (tigm) IST14965B10 (tigm) IST14464E4 (tigm)
IST11314H7 (tigm) IST12794D8 (tigm) IST14073H6 (tigm) IST12296B4 (tigm)
IST10327E7 (tigm) IST10485D2 (tigm) IST13160F10 (tigm) IST11263C5 (tigm)
IST12003B6 (tigm) IST12772F3 (tigm) IST14668G4 (tigm) IST11922G11 (tigm)
IST10752E1 (tigm) IST14073G6 (tigm) IST14558H7 (tigm) IST10526C8 (tigm)
IST10323F12 (tigm) IST14178A5 (tigm) IST13119D7 (tigm) IST12362D6 (tigm)
IST13390E6 (tigm) IST12986F4 (tigm) IST14660H6 (tigm) IST14653E1 (tigm)
IST14337D11 (tigm) IST14445C1 (tigm) IST13573F1 (tigm) IST14530B1 (tigm)
IST13107C10 (tigm) IST14468D8 (tigm) IST11337A7 (tigm) IST10765D2 (tigm)
IST13668F5 (tigm) IST10985F5 (tigm) IST12692A6 (tigm) IST14785D12 (tigm)
IST13057G10 (tigm) IST14536F7 (tigm) IST12907F7 (tigm) IST11206E1 (tigm)
IST14540G8 (tigm) IST12046C2 (tigm) IST12522G7BBF1 (tigm) IST10981D5 (tigm)
IST13158F10 (tigm) IST12794C10 (tigm) IST10330A8 (tigm) IST14214C5 (tigm)
IST12988G4 (tigm) IST14141E5 (tigm) IST12957G2 (tigm) IST11603E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22482
Vector Insertion
Chr 7: 87343404 - 87343657
Public Clones not available
Private Clones OST295836 (lexicon) OST252072 (lexicon) OST251474 (lexicon) OST194938 (lexicon)
OST178161 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24496
Vector Insertion
Chr 7: 87343657 - 87357681
Public Clones (sanger) E324F07 (ggtc) E031B02 (ggtc) D160B02 (ggtc) E051A06 (ggtc)
IST14678A2 (tigm) IST10546C7 (tigm)
Private Clones OST218037 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27708
Vector Insertion
Chr 7: 87357846 - 87358148
Public Clones not available
Private Clones OST52269 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11690
Vector Insertion
Chr 7: 87358212 - 87360509
Public Clones P080E05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11325
Vector Insertion
Chr 7: 87364223 - 87365006
Public Clones G083B08 (ggtc) P082A10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11228
Vector Insertion
Chr 7: 87365218 - 87365327
Public Clones G033C05 (ggtc) P076G08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11284
Vector Insertion
Chr 7: 87365444 - 87365673
Public Clones G074D03 (ggtc) D004A01 (ggtc) IST10677A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35717
Vector Insertion
Chr 7: 87365673 - 87365841
Public Clones IST14462B11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10240
Vector Insertion
Chr 7: 87366719 - 87368819
Public Clones GST107 (baygenomics) G076B12 (ggtc) G074G07 (ggtc)
Private Clones OST441113 (lexicon) OST413413 (lexicon) OST359747 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9826
Vector Insertion
Chr 7: 87368903 - 87369481
Public Clones RST235 (baygenomics) E323C03 (ggtc)
Private Clones OST325048 (lexicon) OST251467 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032754
Sequence
CCAGCATTTCCGGGGACACCGCGCTGGGTGTTCACGGGATACTCCAGGTCCCCAGGGACGACGACCGGCGGGCCAGTCGGAGTCCTGTCGGACTTCCCGG

ACTTCGGGGCCGCGCGGAGGTAGTCCTATCGTGGGACGTAACTCCTTCCAG - UNI10567 - - UNI22482 - GTCCAGAGGCGGAGGCCGAGGG

AAGGACTCCGGGCCGAACCGCGGGGCGGGGCTCCAGCCTGCGATTCCACTTGAGCAACCTGAGCCGGAGGAGGACGCCGCTGCCTGCTGCGGTCCGAGCT

CCACGCGCCGCGATGGGCCGGGCGAGCCGCTCCGCTGTCCTGCGGCGCGCGCTGCTGCTGCTGCTGCTACTGCTGCTGCTGCGGACGACGACTACGCGGG

CGCTCGGCCCCCGGATCAGTGTGCCGCTGG - UNI22482 - - UNI24496 - GCTCTGAAGAAAGGCTGATTAGAAAATTTGAAGCTGAAAACAT

CTCCAACTACACGGCCCTTCTGCTGAGCCAGGATGGCAAGACGCTGTATGTGGGGGCCCGAGAGGCCCTCTTTGCACTTAACAGCAACCTCAGCTTCTTG

CCAGGCGGGGAGTACCAAGAG - UNI27708 - CTGCTGTGGAGTGCAGATGCTGACAGGAAGCAGCAGTGCAGCTTCAAGGGCAAGGACCCAAAG -

 UNI11690 - CGTGACTGTCAAAACTACATCAAGATCCTCCTGCCACTCAACAGCAGCCACCTGCTCACCTGTGGCACGGCCGCCTTCAGCCCCCTGT

GTGCTTACATT CACATAGCGAGCTTTACTTTAGCCCAAGATGAGGCCGGCAATGTCATTCTGGAGGATGGCAAGGGTCGTTGTCCCTTTGACCCCAACT

TCAAGTCCACGGCTCTGGTGGTTG ATGGTGAGCTGTACACTGGAACAGTCAGTAGCTTCCAGGGAAACGACCCAGCCATTTCCCGGAGCCAGAGTTCCC

GCCCCACCAAGACTGAGAGCTCCCTCAACTGGCTACAAG ACCCTGCCTTTGTGGCCTCGGCCTACGTCCCCGAGAGCCTGGGCAGCCCCATAGGTGATG

ATGATAAGATCTACTTCTTCTTCAGCGAGACGGGCCAGGAGTTTGAGTTCTTTGAGAACACCATCGTGTCCCGAGTTGCCCGAGTCTGTAAG GGCGATG

AGGGTGGAGAGCGGGTGTTGCAGCAACGCTGGACCTCCTTTCTCAAGGCTCAGCTCCTGTGCTCCCGGCCTGATGATGGCTTTCCCTTTAACGTGCTACA

AGATGTCTTCACCCTGAACCCCAACCCTCAGGATTGGCGCAAGACCCTTTTCTATGGGGTCTTTACCTCCCAGTG GCACAGAGGGACCACAGAAGGCTC

TGCCATCTGCGTCTTCACCATGAATGATGTGCAGAAGGCCTTTGACGGCCTGTACAAGAAAGTAAACAGAGAGACACAGCAGTGGTATACCGAGACCCAC

CAGGTGCCCACACCGCGGCCGGGAGCG - UNI11325 - TGCATTACCAACAGTGCCCGGGAACGGAAGATCAACTCGTCCCTGCAGCTCCCAGACCG

AGTGCTGAACTTCCTCAAGGATCACTTCTTGATGGATGGGCAGGTCCGCAGTCGCCTGCTGCTGCTGCAGCCCAGAGCCCGCTACCAGCGTGTGGCTGTG

CACCGTGTGCCTGGCCTGCACAGCACTTATGATGTCCTATTTCTGGGCACTG - UNI11228 - GTGATGGCCGCCTGCACAAAGCAGTGACCCTGAG

CTCCAGAGTCCACATCATTGAGGAGCTGCAGATCTTCCCTCAAGGACAGCCTGTGCAGAACCTGCTCTTGGACAGCCATGGG - UNI11284 - - UN

I35717 - GGACTGTTGTATGCCTCCTCCCATTCCGGGGTGGTGCAAGTGCCCGTAGCCAACTGCAGCCTGTACCCAACCTGTGGAGACTGCCTCCTGG

CTCGAGACCCCTACTGCGCCTGGACTGGCTCTGCCTGCAGGCTCGCTAGCCTCTACCAGCCTGATCTGGCCTCCAG - UNI10240 - - UNI35717

 - GCCATGGACCCAGGACATTGAGGGTGCCAGTGTCAAGGAACTCTGCAAGAATTCCTCATACAAGGCCCGGTTTCTTGTGCCAG - UNI9826 - G

TAAGCCATGTAAACAAGTCCAGATCCAACCAAACACAGTGAACACCCTGGCCTGCCCACTCCTCTCAAACCTGGCCACTCGGCTCTGGGTGCACAATGGA

GCCCCAGTCAATGCCTCTGCCTCCTGCCGCGTGTTACCCACCGGGGACCTGCTGCTGGTGGGCAGCCAGCAGGGTTTGGGGGTGTTCCAGTGTTGGTCGA

TAGAAGAAGGATTCCAGCAGCTTGTGGCCAGCTACTGCCCAGAGGTGATGGAGGAGGGGGTAATGGACCAAAAGAACCAGCGTGATGGTACCCCAGTCAT

TATCAACACATCACGAGTGAGTGCACCGGCTGGTGGCAGGGCCAGCTGGGGTGCGGACAAGTCCTACTGGAATGAATTCCTGGTGATGTGTACTCTGTTT

GTGTTTGCTATGGTGCTTTTGTTTCTGTTCTTTCTCTACCGACATCGGGATGGCATGAAACTCTTCCTAAAGCAGGGCGAATGTGCCAGTGTGCACCCCA

AGACTCGCCCTATAGTGCTACCACCTGAGACCCGACCGCTGAATGGTGTCGGCCCTCCTAGCACCCCACTTGACCACCGAGGCTACCAGGCTCTGTCGGA

TAGCTCCCCAGGGCCCAGAGTCTTCACTGAATCAGAGAAGAGGCCACTGAGCATCCAGGACAGCTTTGTAGAGGTGTCTCCCGTGTGTCCCCGGCCCCGA

GTTCGACTGGGCTCTGAGATCCGAGACTCTGTGGTATGAGAGCTGACTTTAGATGTGGTCACCCTGACCTCAGGGGTTGTGAGTGTTCAGTGGAGGTCAG

CTACCTCTGCTTCTCACAGAACACAGCCACGGTACCCTGACTGGAGGGCAGCTGGTACCACAGGCCCAACAGCCCAGCCAGCTGCTTCCAGTGTCTGGCC

GAGAACTGGGCTGCCTCCAGGGGCCAGAGGGTCCTTGTCTGGGTGGCAGAACTCTGCTACTTAACTGAGCCCTTTGTTTAAAACTGCAAATGTGAAGCCA

GAGAGGAAGGAGAAACAGACAAGGAAGACTACAACATAGCCACTCCAGTTCAGCCTGCTGGGCTCTTGGGGACTTCTCCAAAGTGGCTTTGTGAGCAAGC

CGAAGTTGAGAATCCCTCCCCGACTGGACTATTCTACCTTCCGCCTTACTCTGCTGCTGAGGCTACCCTTTCTCACTGCAGAATCAGGGCCCTGCTCCAG

CTTCAGCCAACCGAGGACATATCTGTGACCGCTGACACCCTACCACCTCAGGGACCAGAGGGCTAGGCTGATTCTGCAGCCCTCCTCACCAGACCCTGGG

CTCAGTCCCAGTTCCCGGACTTCTCCAGCCTGTATCAGGCTGTGGCCTCAAAAGCAAGGGAGTGACCCCCAAGGGGGGTTGTGACAGAAGACTTGCCTAC

TGTCCTTTTCCCAGTCAGAGAACTATGTCCCTACCCATCGACGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGTTTTTCGAGACAGGCTTTCTCTGTG

TAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGTCTCGAACTTAGAAATCCGCCTGACTGCCTCCCAAGTGCTGGGATTAAAGGCGTGTGC

CACCACTGCCCGGCCCCACCCATCTTCTAATTCCTACACAGACTCCTGGATCCTCGTTCCTTGTCCTAGCTCACCGTGCCCGTCACTCTAAGGGATGCTG

ACACTGCCCATCACAAGGACCCTGAATTTACATGGGTTTTATATTTTTTTTTAATAAGATGCACTTTACTTTCTTTTTTAAATAAAATCCGACAAATTAT

AGTTATTTGTGGCCCACATTCCTGAAGGGCTTTGCTTTGTGTGTATGTGATATGAATATATGTATATGCGGAGACCAGAGGCTCTCCTTTGCTTTGTGTG

TATGTGATAGGAATATATGTATATGCGG
Translation
 - UNI10567 - - UNI22482 - MGRASRSAVLRRALLLLLLLLLLRTTTTRALGPRISVPLG - UNI22482 - - UNI24496 - GSEERL

IRKFEAENISNYTALLLSQDGKTLYVGAREALFALNSNLSFLPGGEYQE - UNI27708 - LLWSADADRKQQCSFKGKDPK - UNI11690 - RD

CQNYIKILLPLNSSHLLTCGTAAFSPLCAYI HIASFTLAQDEAGNVILEDGKGRCPFDPNFKSTALVVD DGELYTGTVSSFQGNDPAISRSQSSRPTK

TESSLNWLQD DPAFVASAYVPESLGSPIGDDDKIYFFFSETGQEFEFFENTIVSRVARVCK GDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQD

VFTLNPNPQDWRKTLFYGVFTSQW WHRGTTEGSAICVFTMNDVQKAFDGLYKKVNRETQQWYTETHQVPTPRPGA - UNI11325 - CITNSARERK

INSSLQLPDRVLNFLKDHFLMDGQVRSRLLLLQPRARYQRVAVHRVPGLHSTYDVLFLGTG - UNI11228 - GDGRLHKAVTLSSRVHIIEELQIFP

QGQPVQNLLLDSHG - UNI11284 - - UNI35717 - GLLYASSHSGVVQVPVANCSLYPTCGDCLLARDPYCAWTGSACRLASLYQPDLASR - 

UNI10240 - - UNI35717 - RPWTQDIEGASVKELCKNSSYKARFLVPG - UNI9826 - GKPCKQVQIQPNTVNTLACPLLSNLATRLWVHNG

APVNASASCRVLPTGDLLLVGSQQGLGVFQCWSIEEGFQQLVASYCPEVMEEGVMDQKNQRDGTPVIINTSRVSAPAGGRASWGADKSYWNEFLVMCTLF

VFAMVLLFLFFLYRHRDGMKLFLKQGECASVHPKTRPIVLPPETRPLNGVGPPSTPLDHRGYQALSDSSPGPRVFTESEKRPLSIQDSFVEVSPVCPRPR

VRLGSEIRDSVV
Transcript ENSMUST00000107383
Sequence
CCAGCATTTCCGGGGACACCGCGCTGGGTGTTCACGGGATACTCCAGGTCCCCAGGGACGACGACCGGCGGGCCAGTCGGAGTCCTGTCGGACTTCCCGG

ACTTCGGGGCCGCGCGGAGGTAGTCCTATCGTGGGACGTAACTCCTTCCAG - UNI10567 - - UNI22482 - GTCCAGAGGCGGAGGCCGAGGG

AAGGACTCCGGGCCGAACCGCGGGGCGGGGCTCCAGCCTGCGATTCCACTTGAGCAACCTGAGCCGGAGGAGGACGCCGCTGCCTGCTGCGGTCCGAGCT

CCACGCGCCGCGATGGGCCGGGCGAGCCGCTCCGCTGTCCTGCGGCGCGCGCTGCTGCTGCTGCTGCTACTGCTGCTGCTGCGGACGACGACTACGCGGG

CGCTCGGCCCCCGGATCAGTGTGCCGCTGG - UNI22482 - - UNI24496 - GCTCTGAAGAAAGGCTGATTAGAAAATTTGAAGCTGAAAACAT

CTCCAACTACACGGCCCTTCTGCTGAGCCAGGATGGCAAGACGCTGTATGTGGGGGCCCGAGAGGCCCTCTTTGCACTTAACAGCAACCTCAGCTTCTTG

CCAGGCGGGGAGTACCAAGAG - UNI27708 - CTGCTGTGGAGTGCAGATGCTGACAGGAAGCAGCAGTGCAGCTTCAAGGGCAAGGACCCAAAG -

 UNI11690 - CGTGACTGTCAAAACTACATCAAGATCCTCCTGCCACTCAACAGCAGCCACCTGCTCACCTGTGGCACGGCCGCCTTCAGCCCCCTGT

GTGCTTACATT CACATAGCGAGCTTTACTTTAGCCCAAGATGAGGCCGGCAATGTCATTCTGGAGGATGGCAAGGGTCGTTGTCCCTTTGACCCCAACT

TCAAGTCCACGGCTCTGGTGGTTG ATGGTGAGCTGTACACTGGAACAGTCAGTAGCTTCCAGGGAAACGACCCAGCCATTTCCCGGAGCCAGAGTTCCC

GCCCCACCAAGACTGAGAGCTCCCTCAACTGGCTACAAG ACCCTGCCTTTGTGGCCTCGGCCTACGTCCCCGAGAGCCTGGGCAGCCCCATAGGTGATG

ATGATAAGATCTACTTCTTCTTCAGCGAGACGGGCCAGGAGTTTGAGTTCTTTGAGAACACCATCGTGTCCCGAGTTGCCCGAGTCTGTAAG GGCGATG

AGGGTGGAGAGCGGGTGTTGCAGCAACGCTGGACCTCCTTTCTCAAGGCTCAGCTCCTGTGCTCCCGGCCTGATGATGGCTTTCCCTTTAACGTGCTACA

AGATGTCTTCACCCTGAACCCCAACCCTCAGGATTGGCGCAAGACCCTTTTCTATGGGGTCTTTACCTCCCAGTG GCACAGAGGGACCACAGAAGGCTC

TGCCATCTGCGTCTTCACCATGAATGATGTGCAGAAGGCCTTTGACGGCCTGTACAAGAAAGTAAACAGAGAGACACAGCAGTGGTATACCGAGACCCAC

CAGGTGCCCACACCGCGGCCGGGAGCG - UNI11325 - TGCATTACCAACAGTGCCCGGGAACGGAAGATCAACTCGTCCCTGCAGCTCCCAGACCG

AGTGCTGAACTTCCTCAAGGATCACTTCTTGATGGATGGGCAGGTCCGCAGTCGCCTGCTGCTGCTGCAGCCCAGAGCCCGCTACCAGCGTGTGGCTGTG

CACCGTGTGCCTGGCCTGCACAGCACTTATGATGTCCTATTTCTGGGCACTG - UNI11228 - GTGATGGCCGCCTGCACAAAGCAGTGACCCTGAG

CTCCAGAGTCCACATCATTGAGGAGCTGCAGATCTTCCCTCAAGGACAGCCTGTGCAGAACCTGCTCTTGGACAGCCATGGG - UNI11284 - - UN

I35717 - GGACTGTTGTATGCCTCCTCCCATTCCGGGGTGGTGCAAGTGCCCGTAGCCAACTGCAGCCTGTACCCAACCTGTGGAGACTGCCTCCTGG

CTCGAGACCCCTACTGCGCCTGGACTGGCTCTGCCTGCAGGCTCGCTAGCCTCTACCAGCCTGATCTGGCCTCCAGGTGAGAACTCCCAAAGACCCAGTG

ACTCCTCCTCATCTCTGAGCACTGCATCTTCTCTGGGACCCCTGCACATGGTTATTTCTCAGCTCTCTGTGGCCATATAATCTATATGGACCAGATAGAC

AGGGTTTGCCAGAATAAGAAACATCTAGTAAAGAAGATGTGGATTGCCACATGCACATAGCTTATTGTAAGTAGGCTGTTCGGTAAGCCTGTTAGACCAT

TAAAAAGTAGAGTAACATTAGAATTAGAGATGTCTATTGAGAAAACAGAGATGTGCTATTTGGCACAGTGATGCACAGCTTTAATCCTAGCATGCAGGAA

GCAGAAGCAGGAAGATCTTTGTGAATTTAAGACCAGCCAGGACCACATAATGAGACCCCGTCTCCATTTAAATGAAAATAGGAATGAGTCAGCTGAAGTG

GGGTTTGTCTGTAATCCAGTGCCTGGTTTTATTGTTGTTCTGTTGTTTGTTTTTGGTTTTATTGAGGCAGGGTCTCATGTAGCCTAGGATATAGTGGTGG

ATGCTTAGAAGAAGATGGGGTGGCCAGGACCTGCTGGTGCATGCGTATAATCCTACTGTTCAGAAGGTGGAGGCAGGAGGGTCAGAAGTTCAAGGACATC

CTCTGCAACAAAGAGTTTCAAGGCCAGCAGGAGTTACAGGAGACTTTGTCTCACAAAAATGGATGGTGCTGGAGACGTGGCTCAGCAGTTAAGAGCACGG

ACTGCTCTCATAGAGGACCCAGGTTTCATTCCTAAGCTCCCATATCAGGCAGTTTACAACCAACTGCTTAGAACTGGCTTCCTGCATACACCTGGTACAG

GAAATTCACCTAGGTATAGGCAGATGCACATACGTAAAAGGAATACGTAAATAT
Translation
 - UNI10567 - - UNI22482 - MGRASRSAVLRRALLLLLLLLLLRTTTTRALGPRISVPLG - UNI22482 - - UNI24496 - GSEERL

IRKFEAENISNYTALLLSQDGKTLYVGAREALFALNSNLSFLPGGEYQE - UNI27708 - LLWSADADRKQQCSFKGKDPK - UNI11690 - RD

CQNYIKILLPLNSSHLLTCGTAAFSPLCAYI HIASFTLAQDEAGNVILEDGKGRCPFDPNFKSTALVVD DGELYTGTVSSFQGNDPAISRSQSSRPTK

TESSLNWLQD DPAFVASAYVPESLGSPIGDDDKIYFFFSETGQEFEFFENTIVSRVARVCK GDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQD

VFTLNPNPQDWRKTLFYGVFTSQW WHRGTTEGSAICVFTMNDVQKAFDGLYKKVNRETQQWYTETHQVPTPRPGA - UNI11325 - CITNSARERK

INSSLQLPDRVLNFLKDHFLMDGQVRSRLLLLQPRARYQRVAVHRVPGLHSTYDVLFLGTG - UNI11228 - GDGRLHKAVTLSSRVHIIEELQIFP

QGQPVQNLLLDSHG - UNI11284 - - UNI35717 - GLLYASSHSGVVQVPVANCSLYPTCGDCLLARDPYCAWTGSACRLASLYQPDLASR

For any suggestions or comments, please send an email to unitrap@crg.es