Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030629 (Zfand6)
Chromosomal location
Chr 7: 91763564 - 91827900 (-)
Description
zinc finger, AN1-type domain 6 Gene [Source:MGI Symbol;Acc:MGI:1929510]
RefSeq_peptide
NP_075361.2 
UniGene
Mm.209349 Mm.402091 
MGI
MGI:1929510 
Uniprot/SWISSPROT
Q9DCH6 
Human Ortholog
ENSG00000086666 (ZFAND6)
Omim not available
UniTrap UNI14696
Vector Insertion
Chr 7: 91782748 - 91827901
Public Clones (sanger) D026C02 (ggtc) E120A09 (ggtc) 3SE142A03 (ggtc) D032C08 (ggtc)
FHCRC-GT-S1-1G1 (fhcrc) IST14182C8 (tigm) IST15000B11 (tigm) IST14989B4 (tigm)
IST10035B4 (tigm)
Private Clones OST464603 (lexicon) OST455559 (lexicon) OST449209 (lexicon) OST427669 (lexicon)
OST423834 (lexicon) OST410528 (lexicon) OST376923 (lexicon) OST373946 (lexicon)
OST367632 (lexicon) OST367494 (lexicon) OST364440 (lexicon) OST311863 (lexicon)
OST293500 (lexicon) OST275673 (lexicon) OST240596 (lexicon) OST233383 (lexicon)
OST224747 (lexicon) OST215570 (lexicon) OST213596 (lexicon) OST185516 (lexicon)
OST179825 (lexicon) OST172905 (lexicon) OST171359 (lexicon) OST171129 (lexicon)
OST155996 (lexicon) OST134930 (lexicon) OST132580 (lexicon) OST104652 (lexicon)
OST103536 (lexicon) OST103526 (lexicon) OST102958 (lexicon) OST102717 (lexicon)
OST102220 (lexicon) OST101164 (lexicon) OST86126 (lexicon) OST75593 (lexicon)
OST74988 (lexicon) OST72971 (lexicon) OST68604 (lexicon) OST65273 (lexicon)
OST36016 (lexicon) OST34256 (lexicon) OST33511 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24010
Vector Insertion
Chr 7: 91782504 - 91782748
Public Clones not available
Private Clones OST237690 (lexicon) OST202656 (lexicon) OST186784 (lexicon) OST179453 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18892
Vector Insertion
Chr 7: 91781267 - 91782394
Public Clones not available
Private Clones OST412220 (lexicon) OST261513 (lexicon) OST223230 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9245
Vector Insertion
Chr 7: 91766474 - 91769377
Public Clones XG021 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000069537
Sequence
CAGGTTTGGTTGCTTTGGAGTACAGCTTCAAGTGAAGTTAATCTGAGGTGAAGCAAACAGAAAATTGTGGAGGTTTTGTTG - UNI14696 - GTGTG

CAACAGAAGAACATGGCTCAAGAAACTAATCACAGCCAAGCACCTATGCTTTGCTCCACTGGCTGCGGATTTTATGGAAACCCTCGTACAAATGGCATGT

GTTCAGTATGCTATAAAGAACATCTTCAAAGACAGAACAGTAGCAATGGTAGAATAAGCCCACCTG - UNI14696 - - UNI24010 - CAGCTTC

TGTCAGCAGTCTGTCTGAATCCTTACCAGTACAGTGCGCAGATGGCAGTGTCCCAGACGCTCAGTCAGCGCTAGATTCTACGTCTTCATCTATGCAGCCA

GG - UNI18892 - CCCTGTGTCAAATCAGTCACTTTTATCAGAATCTGTAGCACCTTCCCAAGTGGACAGTACATCTGTGGACAAAGCAGTATCTGA

GACAGAAGACCTGCAAG GACCCAGAGCAGAGGGCCTTGTTCCTCTTGAATGTGATCCTCCAT - UNI9245 - CTTCAGTATCAGATACGACACAGC

AGCCATCTGAAGAGCAAAGCAAGTCTCTTGAAAAACCAAAACAAAAAAAGAATCGCTGTTTCATGTGCAGGAAGAAAGTGGGACTTACTG GGTTTGAAT

GCCGGTGTGGAAATGTTTACTGTGGTGTGCACCGTTACTCAGATGTTCACAATTGCTCTTACAATTACAAAGCTGATGCTGCTGAGAAAATCAGAAAAGA

AAATCCAGTAGTTGTTGGTGAAAAGATCCAGAAGATTTGAACTCCTGCTGGAATACAAAATCCTTTGACTATCTGCAAACTAAACATTGACTTGAGGTTT

TTTTTCCTAGTCCTTGGGAATGTAGAGCACCGTATCTTGCATAGACCCTTGAATCATGCATGTCATCAGAAGAATAGATTTTTGGTTTTGTTTTGAAAAT

GACTCTGAACATTTATTTCCATTGCAGTTTCTGTGGCTGAAAAGAAGTATTATACTTTTAAGATCATTTTAATTTTAGTTGAGTGCAGAGGGCTTTTATA

ACAAATGTGGAGAAATTCTGGAGGGCTGTGATTTTTCCAGTATTAAACATGCATGCGTTGATCTTGCAGTTTATTTCTCATTGTGTATGTATATATAGCT

TTTCTCTGCAGCACGATTCCCTTTTGATAAGGCCCTTCTGGGTACAACTAGTTATCAGTAACTGAATGTATCTTAATCATTACGGCTGCTTCTGTTTGTT

TTGTTTTCATTAACAAAGGTTATACATATGTTAGCATATAGTTTCTTTGCACCCACTATTTATGTCTGAATCATTTGTCACAGGAGAATATGTGCTGACG

AGATTCTAAATTTGTGGTTTTTGGTTCCTTTTATTTTTTTTTTTAAGCAAGGGAAAGAAAAGCTGAGTGCATTTCACTGCTGACTGCAAGTTTCTTTGAG

ATTACTGTTCATTGGTCTGTGTGTGCACAATATGAAGAATGAGCTGGTCATTGTGCGGTATTTATGTTTATTCACCAGTCTTTGATTAAATAAAAAGGAA

AACTCG
Translation
 - UNI14696 - MAQETNHSQAPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPA - UNI14696 - - UNI24010 - AASVSSL

SESLPVQCADGSVPDAQSALDSTSSSMQPG - UNI18892 - GPVSNQSLLSESVAPSQVDSTSVDKAVSETEDLQG GPRAEGLVPLECDPPS - U

NI9245 - SSVSDTTQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTG GFECRCGNVYCGVHRYSDVHNCSYNYKADAAEKIRKENPVVVGEKIQKI

For any suggestions or comments, please send an email to unitrap@crg.es