Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030703 (Gdpd3)
Chromosomal location
Chr 7: 133909928 - 133919157 (+)
Description
glycerophosphodiester phosphodiesterase domain containing 3 Gene [Source:MGI Symbol;Acc:MGI:1915866]
RefSeq_dna
NM_024228 
RefSeq_peptide
NP_077190.2 
MGI
MGI:1915866 
Uniprot/SWISSPROT
Q99LY2 
Human Ortholog
ENSG00000102886 (GDPD3)
Omim not available
UniTrap UNI15392
Vector Insertion
Chr 7: 133910124 - 133910415
Public Clones PST9334-NL (escells) IST14563B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13946
Vector Insertion
Chr 7: 133914728 - 133918967
Public Clones CMHD-GT_164B9-3 (cmhd) CMHD-GT_153G11-3 (cmhd)
Private Clones OST4822 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032944
Sequence
GCCCTTTGGGACAGGGAAGGCTGTGCTTTTGACAGAAGCCTGCCGTGGAGCGAGGCTATGATCCCTCTCCTGTACTTTGTTCTGCCCACCCTGGGCAGTT

ACGTCATGCTCTCCATCTTCTTCCTGCGCCGACCTCATCTGCTGCACACGCCGCGGGCTCCCGTCTTCCCTATCCGCCTGGCTGCCCACCGTGGAG - U

NI15392 - GGTCTGGGGAGCGACTGGAGAACACCATGGAAGCAGTAGAGAA TTCCATGGCCCAGCGAGCAGATCTCTTGGAATTTGACTGCCAGCTC

ACCCGGGATGGCGTGGTGGTAGTGTCACACGACAAGAACCTGTCCCGCCAGTCAGGCCTAAATAAGGATGTGAACACCCTGGACTTTGAG GAGCTGCCC

CTCTACAAGGAAGAGTTGGAAATTTACTTCTCACCAG GCCATTTTGCCCACGGGTCAGACCGGCACATGATTAGTTTGGAGGATGTATTCCAGAAATTT

CCAAGGACTCCCATGTGCTTGGAGGTCAAAGAAAGAAATGAAGAACTCATTCACAAG GTAGCCAACCTGACTAGGCGCTTTGACCGGAATGAGATTACT

ATTTGGGCTGCAGAGAAAAGCTCAGTCATGAAGAGATGCAGGGCTGCT AACCCCGAGATGCCCATGGCCTTCACGATATGGCGATCGTTCTGGATACTG

CTGCTCTACTACCTGGGGCTGCTCCCTTTTGTCTCCATCCCTGAGAAGTTTTTCTTCTGTTTCCTGCCCACCATCATCAACAG GACTTACTTCCCATTT

CGCTGTGGATGGATGAACCAACTGTCGGCTACCATTACAAAATG GATCATCATGAGAAAAAGTCTGATCCGACACTTGCAGGACCGAGGGGTGCAG - 

UNI13946 - GTGCTATTTTGGTGCCTTAATGAAGAATCGGATTTTGAAGTGGCCTTCAGCTTGGGAGCCAATGGCGTCATGACCGATTACCCCACAGC

CCTGAGACACTACCTGGACAAGCAGGAAGAAGAGACCCAGCCTCCTCAGCCTGAGGCCCTGTCCTGTCTTTCTCTTAAAAAATAAATATTTTCTTGTCAG

T
Translation
MIPLLYFVLPTLGSYVMLSIFFLRRPHLLHTPRAPVFPIRLAAHRGG - UNI15392 - GSGERLENTMEAVEN NSMAQRADLLEFDCQLTRDGVVV

VSHDKNLSRQSGLNKDVNTLDFE ELPLYKEELEIYFSPG GHFAHGSDRHMISLEDVFQKFPRTPMCLEVKERNEELIHK VANLTRRFDRNEITIWAA

EKSSVMKRCRAA NPEMPMAFTIWRSFWILLLYYLGLLPFVSIPEKFFFCFLPTIINR RTYFPFRCGWMNQLSATITKW WIIMRKSLIRHLQDRGVQ 

- UNI13946 - VLFWCLNEESDFEVAFSLGANGVMTDYPTALRHYLDKQEEETQPPQPEALSCLSLKK

For any suggestions or comments, please send an email to unitrap@crg.es