Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030718 (Ppme1)
Chromosomal location
Chr 7: 107475248 - 107520406 (-)
Description
protein phosphatase methylesterase 1 Gene [Source:MGI Symbol;Acc:MGI:1919840]
RefSeq_dna
NM_028292 
RefSeq_peptide
NP_082568.1 
UniGene
Mm.177502 Mm.475633 
MGI
MGI:1919840 
Uniprot/SWISSPROT
Q8BVQ5 
Human Ortholog
ENSG00000214517 (AP000577.5-202)
Omim not available
UniTrap UNI29658
Vector Insertion
Chr 7: 107503777 - 107520407
Public Clones E124G08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8818
Vector Insertion
Chr 7: 107503312 - 107503777
Public Clones TEA148 (baygenomics) TEA146 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7591
Vector Insertion
Chr 7: 107483688 - 107486879
Public Clones RRR406 (baygenomics) IST14030D5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032963
Sequence
CTGTGACCGGTTGTACTGCACGTATCGTGGGACGGACCTTGGGCCACTGTTGTCGACGTGCGGCCTCCCTTTGATGTCGGCCCTTGAAAAAAGCATGCAC

CTCGGCCGCCTACCTTCTCGCCCTCCTCTACCCGGCAGCGGGGGCAGTCAGAGCGGAGCCAAGATGCGGATGGG - UNI29658 - CCCTGGACGGAA

GCGGGACTTTACCCCTGTCCCATGGAGTCAGTACTTTGAGTCAATGGAAGATGTGGAAGTGGAGAATGAAACTGGCAAGGAT - UNI8818 - - UNI

29658 - ACTTTTCGAGTTTACAAGAGTGGTTCTGAGGGTCCAGTCCTGCTGCTGCTTCATGGAGGAGGCCATTCCGCCCTTTCCTGGGCAGTGTTCAC

G GCAGCAATCATCAGTAGAGTACAGTGTAGGATTGTGGCTCTGGATCTGCGAGGTCACG GAGAAACTAAAGTCAAGAATTCTGAAGACCTGTCAGCAG

AAACAATGGCAAA AGATGTTGGCAATGTGGTGGAAGCCATGTATGGAGACCTCCCTCCTCCAGTCATGCTGATTGGGCACAGCATGGGTGGCGCCATTG

CAGTGCACACAGCCGCAGCTAACCTGGTACCAAGCCTCTTGGGCCTTTGCATGATTGATGTTGTAGAAG GTACCGCCATGGATGCACTTAATAGCATGC

AGAATTTCTTGCGTGGTCGACCTAAAACCTTCAAGTCTTTGGAGAATGCTATTGAATGGAG TGTGAAGAGTGGCCAGATTCGAAACCTTGAGTCTGCCC

GTGTATCCATGGTCGGCCAAGTCAAACA GTGTGAAGGAATTACAAGTCCAGAAGGTTCCAAATCCATAGTGGAAGGAATCATAGAGGAGGAGGAAGAAG

ATGAGGAAGGAAGTGAGTCAGTTAACAAGAGGAAAAAGGAAGACGACATGGAA - UNI7591 - ACCAAGAAGGATCACCCATACACCTGGAGAATTG

AGCTGGCAAAAACAGAAAAGTACTGGGATGGCTGGTTCCGGGGCTTATCCAATCTCTTTCTTAGCTGTCCTATTCCTAAACTGCTGCTCTTGGCAG GTG

TTGACAGATTGGATAAAGATCTGACCATAGGCCAGATGCAGG GGAAGTTCCAGATGCAGGTCTTACCCCAGTGTGGCCATGCAGTCCATGAGGATGCCC

CTGACAAG GTAGCTGAAGCTGTTGCCACTTTCCTGATCCGGCACAGGTTTGCAGAGCCCATTGGAGGATTCCAGTG TGTGTTTCCTGGCTGCTAGTGA

CCTGCTGTCTACTCCTCCCTCTACATTGAGCTCTGTTGTAAATACATCGCACCAGAGGCCACTGTGACGCCGCTGTCTCCTCCTCTCCATCCCGCCCAGC

CATGTGACACCGGCTCTTGTAGAGGGCATCCCCAGATGTCCAAACCCTTTCCTGTGTACTGTTGAAAGCATTGTTCTTCAGGGCCCTTGTCCAACAGTGG

CCCGTGCAGTCTGGGGTCCACAGCTCTTCCTCTCCTTCCTGTGCTCCCTGCCTTGCCTAGGATGAAGCCTCCAGCGCTGCTCCCTGGCCCTGTTCCTGGC

ATATGGCAATGTACCCCAGGCTCAGGGATCTCCCTTCCTTGAGGATGTTCTTGGCATGGTCCTGCCCTACCTCATGGGATGGGCAATGCACACACTGGCC

CTTATTTTTCCCTTTCAAATAAAACACCAGTCAGGTACCTTTATCCCAGTCTTAACTGTCCCAAATCTGGAAGGTCCAGAGTAAGCAGGATTCAGGGAGA

GGGAGTGGATAGCAAGTATCCCAAGAAACCAACCTGTAAGTCAGGTCCAGCCAGTCCAAGCACATGGCTTCCCATCTGGGTGAGCCCACTGTCCCACTCC

CACATGTCTGGGCACCTGCCCTGGGCTGAGGCCAGGCTGCTCCAAGGGCCGCATGAGCCCTAATCTGCCACAGAGCAACCCAGGTTAAACACAGCCCATG

CACAAAGCCACAGGCTAAATCCTGTGGAATTGTTTTTAATGACTGAATTTAACCATTTTCATAGTTGGTTCCTGGAGGTGTGCCAAGTGCCCGCTTGCCT

CTTCTAGACCCACAGCTTCTTGATCCACTTGTGGTTTCCATGTCACTAATGTAGAAACATCATGGACTAGCATCCCCAGTCTTTGCCCTCATCCAGCTGT

CGCAGCGCAGCACTGGGGCCTCCCCCTGCTGCCCAGGGGGGGGGGGGTGGGCAGCCTCCTGAAACCCATCTTTCTGTGACTGTCTTAGGTGACGTGTAGC

CCTCTTCCGTTTTTTCACCCAACAACTTCCTCTGTCCTGCTGCACGGTCCAGAGTCTGGGACCGACTTTGTTTCTTTGTTATTTATGATCTTGTTTAAAG

AAAATAAATATCTCCCAACCTTT
Translation
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMG - UNI29658 - GPGRKRDFTPVPWSQYFESMEDVEVENETGKD - UNI8818 - - UNI29

658 - TFRVYKSGSEGPVLLLLHGGGHSALSWAVFT AAIISRVQCRIVALDLRGHG GETKVKNSEDLSAETMAK KDVGNVVEAMYGDLPPPVMLIG

HSMGGAIAVHTAAANLVPSLLGLCMIDVVEG GTAMDALNSMQNFLRGRPKTFKSLENAIEWS SVKSGQIRNLESARVSMVGQVKQ QCEGITSPEGSK

SIVEGIIEEEEEDEEGSESVNKRKKEDDME - UNI7591 - TKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAG GVDRLDKDLTIG

QMQG GKFQMQVLPQCGHAVHEDAPDK VAEAVATFLIRHRFAEPIGGFQC CVFPGC

For any suggestions or comments, please send an email to unitrap@crg.es