Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030720 (Cln3)
Chromosomal location
Chr 7: 133714721 - 133729331 (-)
Description
ceroid lipofuscinosis, neuronal 3, juvenile (Batten, Spielmeyer-Vogt disease) Gene [Source:MGI (curated);Acc:Cln3-002]
RefSeq_dna
NM_009907 
RefSeq_peptide
NP_034037.2 
UniGene
Mm.268930 
MGI
MGI:107537 
Uniprot/SWISSPROT
Q61124 
Uniprot/SPTREMBL
O35934 Q811D1 Q8C5B1 Q6PAH4 
Human Ortholog
ENSG00000188603 (CLN3)
Omim 204200 - CEROID LIPOFUSCINOSIS, NEURONAL, 3  
UniTrap UNI16931
Vector Insertion
Chr 7: 133727795 - 133728808
Public Clones IST13730D11 (tigm) IST12866E9 (tigm)
Private Clones OST452177 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32806
Vector Insertion
Chr 7: 133726816 - 133727795
Public Clones IST12353E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21977
Vector Insertion
Chr 7: 133725257 - 133726277
Public Clones not available
Private Clones OST312289 (lexicon) OST284767 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000116269
Sequence
GTCTACCTTGCGGAGAGTTCAGCTGCTCTTAAAG - UNI32806 - CTCGGAACACACGCTGACTTTGGGCCCTTTGGGGGACCCGAACTCAATGTTA

TGGGAAGTTCTGCGGGCTCGTGGAGGCGCCTTGAGGATTCTGAGA GGGAGGAGACCGACTCAGAGCCCCAGGCCCCTCGGTTGGATAGTCGGAGTGTCC

TTTGGAAGAATGCAGTGGGTTTCTG - UNI21977 - GATCTTGGGTCTTTGCAACAATTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGACATC

CTCAAGCAGGAGCAGGCGTCTGGAAACCAGAGCCAT GTGGAACCAGGCCCAACACCCACACCCCACAACAGCTCATCTCGATTTGACTGCAACTCCATC

TCCACAGCT GCGGTGCTCCTAGCAGACATCCTTCCCACCCTTGTCATCAAACTCCTGGCGCCTCTTGGCCTTCACTTGCTGCCTTACAG CCCCCGGGT

GCTCGTCAGTGGAGTTTGTTCTGCTGGGAGCTTTGTTCTGGTTGCCTTCTCTCAGTCAGTGGGGTTAAGCCTGTGTG GAGTGGTTTTGGCCAGCATCTC

CTCAGGGCTAGGGGAGGTCACCTTCCTCTCACTGACTGCCTTCTACCCCAG TGCTGTGATCTCATGGTGGTCTTCGGGTACCGGGGGTGCAGGGCTTCT

TGGATCGCTGTCTTACCTGGGACTCACCCAGGCTGGCCTCTCCCCGCAGCACACCCTACTTTCTATGTTGGGGATCCCTGTTCTGCTGCTAGCCAG CTA

TTTCTTGTTGCTCACGTCTCCTGAACCCCTGGACCCTGGAGGGGAAAACGAGGCAGAGACTGCTGCCCGGCAGCCTCTCATAGGCACCGAGACCCCAGAG

TCAAAGCCAG GTGCCAGCTGGGACCTCTCCCTCCAGGAAAGGTGGACAGTGTTCAAG GGTCTCTTGTGGTACATCATCCCTCTGGTGCTGGTCTACTT

TGCAGAATACTTTATCAACCAGGGACTT TTCGAGCTCCTGTTTTTCCGGAACACTTCCCTAAGCCATGCTCAGCAGTACCGATG GTACCAGATGCTAT

ACCAGGCTGGTGTGTTCGCCTCCCGCTCTTCTCTCCAATGTTGCCGAATACGGTTCACCTGGGTCCTAGCCCTGCTCCAG TGCCTCAACCTGGCCCTCC

TGCTGGCAGATGTCTGCTTGAACTTCTTGCCCAGCATCTACCTCATCTTCATCATCATTCTGTACGAAGGGCTCCTGGGTGGGGCCGCTTACGTGAATAC

CTTCCACAACATTGCTCTGGAG ACCAGTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGTATCTCTGACACCTTGGGAATCTCCCTGTCGGGGGT

CCTGGCCCTGCCTCTGCATGACTTCCTCTGTCACCTCCCTTGACAGGAGTTGCTCGACACACACTGATCTGCAGGCACATGAGCAGATCACACATCTTCG

AGCTCTGCCACAGCCTTTCCCTGCCCCACTGCAGCAAGGAGCCCCTGATGTTTCCCACTCCTGAGCTGGCCTCAGAGTTTTCTCCTACCCTCTGCCCTTC

TAATAAATGCTTATTTTAACAGTT
Translation
 - UNI32806 - MGSSAGSWRRLEDSER REETDSEPQAPRLDSRSVLWKNAVGFW - UNI21977 - WILGLCNNFSYVVMLSAAHDILKQEQAS

GNQSH VEPGPTPTPHNSSSRFDCNSISTA AVLLADILPTLVIKLLAPLGLHLLPYS SPRVLVSGVCSAGSFVLVAFSQSVGLSLCG GVVLASISSG

LGEVTFLSLTAFYPS SAVISWWSSGTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIPVLLLAS SYFLLLTSPEPLDPGGENEAETAARQPLIGTETP

ESKPG GASWDLSLQERWTVFK GLLWYIIPLVLVYFAEYFINQGL FELLFFRNTSLSHAQQYRW WYQMLYQAGVFASRSSLQCCRIRFTWVLALLQ 

CLNLALLLADVCLNFLPSIYLIFIIILYEGLLGGAAYVNTFHNIALE TSDKHREFAMEAACISDTLGISLSGVLALPLHDFLCHLP
Transcript ENSMUST00000106380
Sequence
GTCTACCTTGCGGAGAGTTCAGCTGCTCTTAAAG - UNI32806 - CTCGGAACACACGCTGACTTTGGGCCCTTTGGGGGACCCGAACTCAATGTTA

TGGGAAGTTCTGCGGGCTCGTGGAGGCGCCTTGAGGATTCTGAGA GGGAGGAGACCGACTCAGAGCCCCAGGCCCCTCGGTTGGATAGTCGGAGTGTCC

TTTGGAAGAATGCAGTGGGTTTCTG - UNI21977 - GATCTTGGGTCTTTGCAACAATTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGACATC

CTCAAGCAGGAGCAGGCGTCTGGAAACCAGAGCCAT GCGGTGCTCCTAGCAGACATCCTTCCCACCCTTGTCATCAAACTCCTGGCGCCTCTTGGCCTT

CACTTGCTGCCTTACAG CCCCCGGGTGCTCGTCAGTGGAGTTTGTTCTGCTGGGAGCTTTGTTCTGGTTGCCTTCTCTCAGTCAGTGGGGTTAAGCCTG

TGTG GAGTGGTTTTGGCCAGCATCTCCTCAGGGCTAGGGGAGGTCACCTTCCTCTCACTGACTGCCTTCTACCCCAG TGCTGTGATCTCATGGTGGTC

TTCGGGTACCGGGGGTGCAGGGCTTCTTGGATCGCTGTCTTACCTGGGACTCACCCAGGCTGGCCTCTCCCCGCAGCACACCCTACTTTCTATGTTGGGG

ATCCCTGTTCTGCTGCTAGCCAG CTATTTCTTGTTGCTCACGTCTCCTGAACCCCTGGACCCTGGAGGGGAAAACGAGGCAGAGACTGCTGCCCGGCAG

CCTCTCATAGGCACCGAGACCCCAGAGTCAAAGCCAG GTGCCAGCTGGGACCTCTCCCTCCAGGAAAGGTGGACAGTGTTCAAG GGTCTCTTGTGGTA

CATCATCCCTCTGGTGCTGGTCTACTTTGCAGAATACTTTATCAACCAGGGACTT TTCGAGCTCCTGTTTTTCCGGAACACTTCCCTAAGCCATGCTCA

GCAGTACCGATG GTACCAGATGCTATACCAGGCTGGTGTGTTCGCCTCCCGCTCTTCTCTCCAATGTTGCCGAATACGGTTCACCTGGGTCCTAGCCCT

GCTCCAG TGCCTCAACCTGGCCCTCCTGCTGGCAGATGTCTGCTTGAACTTCTTGCCCAGCATCTACCTCATCTTCATCATCATTCTGTACGAAGGGCT

CCTGGGTGGGGCCGCTTACGTGAATACCTTCCACAACATTGCTCTGGAG ACCAGTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGTATCTCTGA

CACCTTGGGAATCTCCCTGTCGGGGGTCCTGGCCCTGCCTCTGCATGACTTCCTCTGTCACCTCCCTTGACAGGAGTTGCTCGACACACACTGATCTGCA

GGCACATGAGCAGATCACACATCTTCGAGCTCTGCCACAGCCTTTCCCTGCCCCACTGCAGCAAGGAGCCCCTGATGTTTCCCACTCCTGAGCTGGCCTC

AGAGTTTTCTCCTACCCTCTGCCCTTCTAATAAATGCTTATTTTAACAGTT
Translation
 - UNI32806 - MGSSAGSWRRLEDSER REETDSEPQAPRLDSRSVLWKNAVGFW - UNI21977 - WILGLCNNFSYVVMLSAAHDILKQEQAS

GNQSH AVLLADILPTLVIKLLAPLGLHLLPYS SPRVLVSGVCSAGSFVLVAFSQSVGLSLCG GVVLASISSGLGEVTFLSLTAFYPS SAVISWWSS

GTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIPVLLLAS SYFLLLTSPEPLDPGGENEAETAARQPLIGTETPESKPG GASWDLSLQERWTVFK GL

LWYIIPLVLVYFAEYFINQGL FELLFFRNTSLSHAQQYRW WYQMLYQAGVFASRSSLQCCRIRFTWVLALLQ CLNLALLLADVCLNFLPSIYLIFII

ILYEGLLGGAAYVNTFHNIALE TSDKHREFAMEAACISDTLGISLSGVLALPLHDFLCHLP
Transcript ENSMUST00000084589
Sequence
AGGTTCTCAGAGGCTCCCCACTGCTTGCTTCCTCTTCACCGTGCTCCCAGATCTCCTGGGCTGTATTACTGCTCCTGTCTCTGTGAGTCCCAGGCTCTGC

CTCAGGCTTCAGTGGGACACTTGGCTCCTGGCCCCTGGCATCCTCAGCTGCCTTCCAGGACCCAGTGTCCTGCCTTTCTGCTTGGGGCCTTGCAGAGCTA

TCTGCTCTCCACCCCCAGGTCTGTTCACCAGCTAAACTTCCTTCTTGGCATCTTCTAGTCTCTTCGGGTGCTTCTACCCCCTCACTCTGGCCACTTCTAA

GTCCCTCCAGTACCTCCTGGGCTTCCTCTCCTACAACCTTCCCCTCAGTCACCTCTCCCAGTTCCTCAGCTGCCTGTGTCTGCCTCTCTACTGTGGGGAC

TGTGTCTCCTACGAGGTAGGACACAAACGCACTGAAGGAGTCCTAGAAGAGAAGAAAGAAGAGTGAAGGCACTCAGGGGAGGTCTAACCACTTCCCCAGG

AGTACACTGTTAACAAAGCCCAG - UNI16931 - - UNI32806 - GTGGTTGAAAAGACCCGGGAGAAGTGGGCAGAGGCTGCTGGAATCCATAG

CAGAGGAATAGGCTTGATGAAGAATGGTCAAGATGCTGCCCTGCCATCGAGTGGAAG - UNI32806 - TTTGAGAAGTCCAAAGGCGAAAAAGAGAA

AAAAGGACCCGGAAGTAAGAAGCAACCCTCAAGCACGTGATGGAAGGCTCACGGGTACTGTCACGTGACCCCCAACCTGCTCGTCTACCTTGCGGAGAGT

TCAGCTGCTCTTAAAG - UNI32806 - CTCGGAACACACGCTGACTTTGGGCCCTTTGGGGGACCCGAACTCAATGTTATGGGAAGTTCTGCGGGCT

CGTGGAGGCGCCTTGAGGATTCTGAGA GGGAGGAGACCGACTCAGAGCCCCAGGCCCCTCGGTTGGATAGTCGGAGTGTCCTTTGGAAGAATGCAGTGG

GTTTCTG - UNI21977 - GATCTTGGGTCTTTGCAACAATTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGACATCCTCAAGCAGGAGCAGGCG

TCTGGAAACCAGAGCCAT GTGGAACCAGGCCCAACACCCACACCCCACAACAGCTCATCTCGATTTGACTGCAACTCCATCTCCACAGCT GCGGTGCT

CCTAGCAGACATCCTTCCCACCCTTGTCATCAAACTCCTGGCGCCTCTTGGCCTTCACTTGCTGCCTTACAG CCCCCGGGTGCTCGTCAGTGGAGTTTG

TTCTGCTGGGAGCTTTGTTCTGGTTGCCTTCTCTCAGTCAGTGGGGTTAAGCCTGTGTG GAGTGGTTTTGGCCAGCATCTCCTCAGGGCTAGGGGAGGT

CACCTTCCTCTCACTGACTGCCTTCTACCCCAG TGCTGTGATCTCATGGTGGTCTTCGGGTACCGGGGGTGCAGGGCTTCTTGGATCGCTGTCTTACCT

GGGACTCACCCAGGCTGGCCTCTCCCCGCAGCACACCCTACTTTCTATGTTGGGGATCCCTGTTCTGCTGCTAGCCAG CTATTTCTTGTTGCTCACGTC

TCCTGAACCCCTGGACCCTGGAGGGGAAAACGAGGCAGAGACTGCTGCCCGGCAGCCTCTCATAGGCACCGAGACCCCAGAGTCAAAGCCAG GTGCCAG

CTGGGACCTCTCCCTCCAGGAAAGGTGGACAGTGTTCAAG GGTCTCTTGTGGTACATCATCCCTCTGGTGCTGGTCTACTTTGCAGAATACTTTATCAA

CCAGGGACTT TTCGAGCTCCTGTTTTTCCGGAACACTTCCCTAAGCCATGCTCAGCAGTACCGATG GTACCAGATGCTATACCAGGCTGGTGTGTTCG

CCTCCCGCTCTTCTCTCCAATGTTGCCGAATACGGTTCACCTGGGTCCTAGCCCTGCTCCAG TGCCTCAACCTGGCCCTCCTGCTGGCAGATGTCTGCT

TGAACTTCTTGCCCAGCATCTACCTCATCTTCATCATCATTCTGTACGAAGGGCTCCTGGGTGGGGCCGCTTACGTGAATACCTTCCACAACATTGCTCT

GGAG ACCAGTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGTATCTCTGACACCTTGGGAATCTCCCTGTCGGGGGTCCTGGCCCTGCCTCTGCA

TGACTTCCTCTGTCACCTCCCTTGACAGGAGTTGCTCGACACACACTGATCTGCAGGCACATGAGCAGATCACACATCTTCGAGCTCTGCCACAGCCTTT

CCCTGCCCCACTGCAGCAAGGAGCCCCTGATGTTTCCCACTCCTGAGCTGGCCTCAGAGTTTTCTCCTACCCTCTGCCCTTCTAATAAATGCTTATTTTA

ACAGTTTCCTTTTTGTGCAGTCTCTGAAACGGAAAGTTTACATAAGCCCACTGTGAAAGATATATGTATTTATGAATGTATAAAGTATTTCAGACAAGGT

GTGGCACACACCTGTAATTCCAGCACTCAGCAGACTGGAGAATCCAAGTTCACGTCTGACTGGGATATACGGTGAGACCCTGAGGACTAGGGCTATAGTT

CAGTGGTAGAGTACTTGCCCAGGATGTCCTGGGCTCTCAGTTTTATCCCTGGAAAACAATTCAAAAGCAGCGTATGCTAATATAAGCCTGTAGTCCCAGG

ATTGGGGAGGTAGAGACAGGAGGATCCAGAGTTCATGGTCCTCAGCTACATAGGAAACCAAGGTCAGCCTGGCCTACATAAGATCTTGTTTTACAATAAT

TACATTGTGTATTTCTGGCTTCTTTATAAAAAAAAATCAAATGTCCATAGGTATGTAGATTTATATCTGGGTCTTCGATTCCATTGATCAACTTGTCTGT

TTTTATGCCAATACTGTGTGGGTTTTATTACTATAACTCTGTAGTAGTGCTTGAAATAAGGATGGTGATACCTCCAGGAGTTCTATTACTGTACAGAGTT

GTTTTAGCAATCCTGTGTTTCTTGTTTTTTTCATATGAAATTGAGTATTGTTCTTTCAAGGTCTATAAAGAATTGTGTTGGAATTTTGATGGACAACTGA

TTTCTTTCTTCAATGTCTTAAAGTTTTTATCATATAACTCTTTGACTTGCTTGGTTAGATTGACCCTACAATATTCATAGAAGACGAAGTGGGTAGTAGC

CCTGAACGAATGTCACAGGAGACAACTTCCTGAACAGAACACCAATAGTTCAGGCACTAAAATTGACAATAAACCAGATCTCATG
Translation
 - UNI16931 - - UNI32806 -  - UNI32806 -  - UNI32806 - MGSSAGSWRRLEDSER REETDSEPQAPRLDSRSVLWKNAVGFW 

- UNI21977 - WILGLCNNFSYVVMLSAAHDILKQEQASGNQSH VEPGPTPTPHNSSSRFDCNSISTA AVLLADILPTLVIKLLAPLGLHLLPYS 

SPRVLVSGVCSAGSFVLVAFSQSVGLSLCG GVVLASISSGLGEVTFLSLTAFYPS SAVISWWSSGTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIP

VLLLAS SYFLLLTSPEPLDPGGENEAETAARQPLIGTETPESKPG GASWDLSLQERWTVFK GLLWYIIPLVLVYFAEYFINQGL FELLFFRNTSLS

HAQQYRW WYQMLYQAGVFASRSSLQCCRIRFTWVLALLQ CLNLALLLADVCLNFLPSIYLIFIIILYEGLLGGAAYVNTFHNIALE TSDKHREFAME

AACISDTLGISLSGVLALPLHDFLCHLP
Transcript ENSMUST00000032962
Sequence
GGGTGGGGCGTGGGTGAACACGAGCTGGAGATCTGGGGATCCTTCGACGGACATGTCGTGTATAGCAGACAGCGGAACCTGGGACTGACCGCGGGGCATT

GATCCTTCGCACCCACCTGTCCCAGACTTTAATCTGTTTTCTTGAAGCTAGCTCGGAACACACGCTGACTTTGGGCCCTTTGGGGGACCCGAACTCAATG

TTATGGGAAGTTCTGCGGGCTCGTGGAGGCGCCTTGAGGATTCTGAGA GGGAGGAGACCGACTCAGAGCCCCAGGCCCCTCGGTTGGATAGTCGGAGTG

TCCTTTGGAAGAATGCAGTGGGTTTCTG - UNI21977 - GATCTTGGGTCTTTGCAACAATTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGAC

ATCCTCAAGCAGGAGCAGGCGTCTGGAAACCAGAGCCAT GTGGAACCAGGCCCAACACCCACACCCCACAACAGCTCATCTCGATTTGACTGCAACTCC

ATCTCCACAGCT GCGGTGCTCCTAGCAGACATCCTTCCCACCCTTGTCATCAAACTCCTGGCGCCTCTTGGCCTTCACTTGCTGCCTTACAG CCCCCG

GGTGCTCGTCAGTGGAGTTTGTTCTGCTGGGAGCTTTGTTCTGGTTGCCTTCTCTCAGTCAGTGGGGTTAAGCCTGTGTG GAGTGGTTTTGGCCAGCAT

CTCCTCAGGGCTAGGGGAGGTCACCTTCCTCTCACTGACTGCCTTCTACCCCAG TGCTGTGATCTCATGGTGGTCTTCGGGTACCGGGGGTGCAGGGCT

TCTTGGATCGCTGTCTTACCTGGGACTCACCCAGGCTGGCCTCTCCCCGCAGCACACCCTACTTTCTATGTTGGGGATCCCTGTTCTGCTGCTAGCCAG 

CTATTTCTTGTTGCTCACGTCTCCTGAACCCCTGGACCCTGGAGGGGAAAACGAGGCAGAGACTGCTGCCCGGCAGCCTCTCATAGGCACCGAGACCCCA

GAGTCAAAGCCAG GTGCCAGCTGGGACCTCTCCCTCCAGGAAAGGTGGACAGTGTTCAAG GGTCTCTTGTGGTACATCATCCCTCTGGTGCTGGTCTA

CTTTGCAGAATACTTTATCAACCAGGGACTT TTCGAGCTCCTGTTTTTCCGGAACACTTCCCTAAGCCATGCTCAGCAGTACCGATG GTACCAGATGC

TATACCAGGCTGGTGTGTTCGCCTCCCGCTCTTCTCTCCAATGTTGCCGAATACGGTTCACCTGGGTCCTAGCCCTGCTCCAG TGCCTCAACCTGGCCC

TCCTGCTGGCAGATGTCTGCTTGAACTTCTTGCCCAGCATCTACCTCATCTTCATCATCATTCTGTACGAAGGGCTCCTGGGTGGGGCCGCTTACGTGAA

TACCTTCCACAACATTGCTCTGGAG ACCAGTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGTATCTCTGACACCTTGGGAATCTCCCTGTCGGG

GGTCCTGGCCCTGCCTCTGCATGACTTCCTCTGTCACCTCCCTTGACAGGAGTTGCTCGACACACACTGATCTGCAGGCACATGAGCAGATCACACATCT

TCGAGCTCTGCCACAGCCTTTCCCTGCCCCACTGCAGCAAGGAGCCCCTGATGTTTCCCACTCCTGAGCTGGCCTCAGAGTTTTCTCCTACCCTCTGCCC

TTCTAATAAATGCTTATTTTAACAGTTTCCTTTTTGTGCAGTCTCTGAAACGGAAAGTTTACATAAGCCCACTGTGAAAGATATATGTATTTATGAATGT

ATAAAGTATTTCAGACAAGGTGTGGCACACACCTGTAATTCCAGCACTCAGCAGACTGGAGAATCCAAGTTCACGTCTGACTGGGATATACGGTGAGACC

CTGAGGACTAGGGCTATAGTTCAGTGGTAGAGTACTTGCCCAGGATGTCCTGGGCTCTCAGTTTTATCCCTGGAAAACAATTCAAAAGCAGCGTATGCTA

ATATAAGCCTGTAGTCCCAGGATTGGGGAGGTAGAGACAGGAGGATCCAGAGTTCATGGTCCTCAGCTACATAGGAAACCAAGGTCAGCCTGGCCTACAT

AAGATCTTGTTTTACAATAATTACATTGTGTATTTCTGGCTTCTTTATAAAAAAAAATCAAATGTCCATAGGTATGTAGATTTATATCTGGGTCTTCGAT

TCCATTGATCAACTTGTCTGTTTTTATGCCAATACTGTGTGGGTTTTATTACTATAACTCTGTAGTAGTGCTTGAAATAAGGATGGTGATACCTCCAGGA

GTTCTATTACTGTACAGAGTTGTTTTAGCAATCCTGTGTTTCTTGTTTTTTTCATATGAAATTGAGTATTGTTCTTTCAAGGTCTATAAAGAATTGTGTT

GGAATTTTGATGG
Translation
MGSSAGSWRRLEDSER REETDSEPQAPRLDSRSVLWKNAVGFW - UNI21977 - WILGLCNNFSYVVMLSAAHDILKQEQASGNQSH VEPGPTPT

PHNSSSRFDCNSISTA AVLLADILPTLVIKLLAPLGLHLLPYS SPRVLVSGVCSAGSFVLVAFSQSVGLSLCG GVVLASISSGLGEVTFLSLTAFYP

S SAVISWWSSGTGGAGLLGSLSYLGLTQAGLSPQHTLLSMLGIPVLLLAS SYFLLLTSPEPLDPGGENEAETAARQPLIGTETPESKPG GASWDLSL

QERWTVFK GLLWYIIPLVLVYFAEYFINQGL FELLFFRNTSLSHAQQYRW WYQMLYQAGVFASRSSLQCCRIRFTWVLALLQ CLNLALLLADVCLN

FLPSIYLIFIIILYEGLLGGAAYVNTFHNIALE TSDKHREFAMEAACISDTLGISLSGVLALPLHDFLCHLP
Transcript ENSMUST00000098036
Sequence
GTGTATAGCAGACAGCGGAACCTGGGACTGACCGCGGGGCATTGATCCTTCGCACCCACCTGTCCCAGACTTTAATCTGTTTTCTTGAAGCTAGCTCGGA

ACACACGCTGACTTTGGGCCCTTTGGGGGACCCGAACTCAATGTTATGGGAAGTTCTGCGGGCTCGTGGAGGCGCCTTGAGGATTCTGAGA GGGAGGAG

ACCGACTCAGAGCCCCAGGCCCCTCGGTTGGATAGTCGGAGTGTCCTTTGGAAGAATGCAGTGGGTTTCTG - UNI21977 - GATCTTGGGTCTTTG

CAACAATTTCTCATATGTGGTGATGCTGAGCGCTGCCCATGACATCCTCAAGCAGGAGCAGGCGTCTGGAAACCAGAGCCAT GCGGTGCTCCTAGCAGA

CATCCTTCCCACCCTTGTCATCAAACTCCTGGCGCCTCTTGGCCTTCACTTGCTGCCTTACAG CCCCCGGGTGCTCGTCAGTGGAGTTTGTTCTGCTGG

GAGCTTTGTTCTGGTTGCCTTCTCTCAGTCAGTGGGGTTAAGCCTGTGTG GAGTGGTTTTGGCCAGCATCTCCTCAGGGCTAGGGGAGGTCACCTTCCT

CTCACTGACTGCCTTCTACCCCAG TGCTGTGATCTCATGGTGGTCTTCGGGTACCGGGGGTGCAGGGCTTCTTGGATCGCTGTCTTACCTGGGACTCAC

CCAGGCTGGCCTCTCCCCGCAGCACACCCTACTTTCTATGTTGGGGATCCCTGTTCTGCTGCTAGCCAG CTATTTCTTGTTGCTCACGTCTCCTGAACC

CCTGGACCCTGGAGGGGAAAACGAGGCAGAGACTGCTGCCCGGCAGCCTCTCATAGGCACCGAGACCCCAGAGTCAAAGCCAG GTGCCAGCTGGGACCT

CTCCCTCCAGGAAAGGTGGACAGTGTTCAAG GGTCTCTTGTGGTACATCATCCCTCTGGTGCTGGTCTACTTTGCAGAATACTTTATCAACCAGGGACT

T TTCGAGCTCCTGTTTTTCCGGAACACTTCCCTAAGCCATGCTCAGCAGTACCGATG GTACCAGATGCTATACCAGGCTGGTGTGTTCGCCTCCCGCT

CTTCTCTCCAATGTTGCCGAATACGGTTCACCTGGGTCCTAGCCCTGCTCCAG TGCCTCAACCTGGCCCTCCTGCTGGCAGATGTCTGCTTGAACTTCT

TGCCCAGCATCTACCTCATCTTCATCATCATTCTGTACGAAGGGCTCCTGGGTGGGGCCGCTTACGTGAATACCTTCCACAACATTGCTCTGGAG ACCA

GTGACAAGCACCGAGAGTTTGCCATGGAAGCTGCCTGTATCTCTGACACCTTGGGAATCTCCCTGTCGGGGGTCCTGGCCCTGCCTCTGCATGACTTCCT

CTGTCACCTCCCTTGACAGGAGTTGCTCGACACACACTGATCTGCAGGCACATGAGCAGATCACACATCTTCGAGCTCTGCCACAGCCTTTCCCTGCCCC

ACTGCAGCAAGGAGCCCCTGATGTTTCCCACTCCTGAGCTGGCCTCAGAGTTTTCTCCTACCCTCTGCCCTTCTAATAAATGCTTATTTTAACAGTT
Translation
MGSSAGSWRRLEDSER REETDSEPQAPRLDSRSVLWKNAVGFW - UNI21977 - WILGLCNNFSYVVMLSAAHDILKQEQASGNQSH AVLLADIL

PTLVIKLLAPLGLHLLPYS SPRVLVSGVCSAGSFVLVAFSQSVGLSLCG GVVLASISSGLGEVTFLSLTAFYPS SAVISWWSSGTGGAGLLGSLSYL

GLTQAGLSPQHTLLSMLGIPVLLLAS SYFLLLTSPEPLDPGGENEAETAARQPLIGTETPESKPG GASWDLSLQERWTVFK GLLWYIIPLVLVYFAE

YFINQGL FELLFFRNTSLSHAQQYRW WYQMLYQAGVFASRSSLQCCRIRFTWVLALLQ CLNLALLLADVCLNFLPSIYLIFIIILYEGLLGGAAYVN

TFHNIALE TSDKHREFAMEAACISDTLGISLSGVLALPLHDFLCHLP

For any suggestions or comments, please send an email to unitrap@crg.es