Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030727 (Rabep2)
Chromosomal location
Chr 7: 133572580 - 133589415 (+)
Description
rabaptin, RAB GTPase binding effector protein 2 Gene [Source:MGI (curated);Acc:Rabep2-001]
RefSeq_peptide
NP_085043.2 
UniGene
Mm.35467 
MGI
MGI:1917564 
Uniprot/SWISSPROT
Q91WG2 
Uniprot/SPTREMBL
Q3TZJ2 
Human Ortholog
ENSG00000177548 (RABEP2)
Omim not available
UniTrap UNI14704
Vector Insertion
Chr 7: 133573300 - 133579173
Public Clones (ggtc) PST13717-NL (escells) PST15483-NR (escells) PST10292-NR (escells)
PST15355-NR (escells)
Private Clones OST385916 (lexicon) OST106731 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36685
Vector Insertion
Chr 7: 133582421 - 133583679
Public Clones IST14600H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36570
Vector Insertion
Chr 7: 133583961 - 133585350
Public Clones IST14912G7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106407
Sequence
GAGCGGACCCGGAAGCGGGAGTGCCATCACCAGTGAGTGCGGGAATCCGCCGTTTGGGCTGAGACGATGGCAGCTGCGCCAGCAACCCTAG CGCTGGAT

CCCCAGCCCCAAGAGAAGCAAAAGGATGCATCCGAGTCAAGTGAGCTCAGTCGGCTTCGTGCCGAACTGGCCGGTGCCCTGGCAGAAATGGAAACCATGA

AGGCTGTAGCTGAGGTGAGCGAGAGCACCAAGGCGGAGGCAGTGGCTGCAGTGCAGAGACAGTGCCAAGAGGAGGTGGCCTCCCTGCAGGCCATCCTGAA

AG - UNI14704 - ACTCCATCAGCAGCTACGAGACCCAGATCGCAGCCCTGAAACAGGAGCGGCAGCAGCAACAGCAGGACTTTGAGGAGAAGGATC

GAGAGCTGGGCCACCTCAAACAGCTGCTGGCCCGGGCCCACCCTTTGGACTCCTTGGAGAAGCAAATGGAAAAG GCTCATGAAGACTCGGAAAAGCTTC

GAGAGATCGTGTTGCCCATGGAGCAGGAGATTACCGAGCTGAAGGGGAAGCTGCAGAGGGCGGAAGAGCTGATCCAAGAGATCCAG AGACGACCACGGC

AGCCTGCCTCCCTGCATGGCTCCACAGAGTTGCTCCCTCTGTCGAGGAACCCCTCACCCCCACTGGAACCCTTGGAGGAGCCGAGCGGAGACGCCGGCCC

AGCCGCCGAGGCCTTTGCCCACAACTGCGATGACAGTGCCTCCATCTCTTCCTTCTCCCTCGGTGGGGCCGCCGGCAGTGCCTCCCTACGAGGCCCCCAA

GGCCTCAGCCCTGAGCAGGAAGAGACTGCTTCTCTGGTGTCTACTGGCACTCTGGTCCCTGAGGGCATCTTCCTGCCCCCTCCTGGGTACCAGCTTGTTC

CAGATAGCCAGTGGGAGCAACTGCAGGTAGAG - UNI36685 - GGGCGGCAGCTGCAGAAGGAGCTGGAAAGTGTCAGCCGGGAGCGGGATGAGCTG

CAGGAAGGACTAAGACGGAGCAATGAAGACTGTGCCAAGCAG ATGCAGGTGCTCCTGGCCCAGGTCCAGAACTCAGAGCAGCTGCTCCGAACTCTGCAA

GGAACTGTGAGCCAGGCCCAAGAGCGCGTGCAGCTGCAGATG - UNI36570 - GCAGAACTGGCCACTTCTCACAAGTGCCTGAGCCAAGAGGTTAA

AAGACTGAATGAAGAAAATCAAGGGCTCCGGGCTGAGCAGCTGCCATCCTCTGCCCTTCAGGGCTCAGAGCAGCGGGAGGACCAGGACGAGGCCCTGCCA

AGCTCCATACAG GAGCTACATCTGCTGGTGCAGAATACCAGGCAACAGGCGCGGGCCAGGCAGCAGGCACAGGAGCATGAGGCTGAGCGCCTGCGCATT

GAAATTGTGAAGCTGCGGGAGGCACTGGACGAGGAGACAGCAGCCAAGGCCAGTCTGGAGAGACAGCTGAGGGTGCAGCGAGAAGAGACAG ACGTGCTG

GAGG CCTCACTGTGCAGCCTGAGAATAGAGACGGAGCGGGTCCAGCAGGAGCAGCGCAAG GCCCAGCTCACGGATCTCCTCTCAGAGCAGAGAGCCAA

GACACTCCGGCTGCAGGCTGAGCTGGAGACCAGTGAACAGGTGCAGAGGGACTTTGTACGGCTGTCCCAGGCCCTACAG GTACGCCTGGAGCGGATCCG

CCAAGCAGAGACTCTGCAGCAAGTGCGTAGCATCCTGGATGAGGCGCCCCTCAGGGACATCAGGGACATTAAAGACTCTTGAGGGGCCAGGCGAGAGGCT

TCCCTGCTGGGGAAGCTGCCCCTTTCTCTACAAGAACTATGAGGCATGGACTGCAGGTCTCAGAACTGGAGTCCCATCAGCTGCAAACCTGGATGGTGGT

GTCCCTAGGGCCACTACTTCCACCCAGGGTGGCTGGGCCTGCCCTCAGGGATGATACCTGGAAAAGGGTCCCAGCCTCCTTCCAGAACCAAAGTGCAGGC

TGAGCCAGGTGGCTTTCGGGCTACCATGCTCCCTCATGGATCCAGCTCTCCCACCCTGTCACCTCAGGCCAGTAGCCAGTCCCAGTCTCTGGCACGCCCA

GCTTGTGGCTAGAAGCTGGTGGATTCAGTGGGCTCCTCGCACAGAGGCCCTGGGACATACAACTGCTTTCTGGACTGTACGACACTAAGGTATTTGTCCG

TAGGCACCTGAAACAGGCCCCAAGATATAAGGAAGCAAGGCCAGACTTTTCTGTCATTTATTTTCAATAAATAAGCAATCAGCT
Translation
MAAAPATLA ALDPQPQEKQKDASESSELSRLRAELAGALAEMETMKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKD - UNI14704 - DSISS

YETQIAALKQERQQQQQDFEEKDRELGHLKQLLARAHPLDSLEKQMEK AHEDSEKLREIVLPMEQEITELKGKLQRAEELIQEIQ RRPRQPASLHGST

ELLPLSRNPSPPLEPLEEPSGDAGPAAEAFAHNCDDSASISSFSLGGAAGSASLRGPQGLSPEQEETASLVSTGTLVPEGIFLPPPGYQLVPDSQWEQLQ

VE - UNI36685 - GRQLQKELESVSRERDELQEGLRRSNEDCAKQ MQVLLAQVQNSEQLLRTLQGTVSQAQERVQLQM - UNI36570 - AELA

TSHKCLSQEVKRLNEENQGLRAEQLPSSALQGSEQREDQDEALPSSIQ ELHLLVQNTRQQARARQQAQEHEAERLRIEIVKLREALDEETAAKASLERQ

LRVQREETD DVLEA ASLCSLRIETERVQQEQRK AQLTDLLSEQRAKTLRLQAELETSEQVQRDFVRLSQALQ VRLERIRQAETLQQVRSILDEAPL

RDIRDIKDS
Transcript ENSMUST00000032971
Sequence
GAGCGGACCCGGAAGCGGGAGTGCCATCACCAGTGAGTGCGGGAATCCGCCGTTTGGGCTGAGACGATGGCAGCTGCGCCAGCAACCCTAG CGCTGGAT

CCCCAGCCCCAAGAGAAGCAAAAGGATGCATCCGAGTCAAGTGAGCTCAGTCGGCTTCGTGCCGAACTGGCCGGTGCCCTGGCAGAAATGGAAACCATGA

AGGCTGTAGCTGAGGTGAGCGAGAGCACCAAGGCGGAGGCAGTGGCTGCAGTGCAGAGACAGTGCCAAGAGGAGGTGGCCTCCCTGCAGGCCATCCTGAA

AG - UNI14704 - ACTCCATCAGCAGCTACGAGACCCAGATCGCAGCCCTGAAACAGGAGCGGCAGCAGCAACAGCAGGACTTTGAGGAGAAGGATC

GAGAGCTGGGCCACCTCAAACAGCTGCTGGCCCGGGCCCACCCTTTGGACTCCTTGGAGAAGCAAATGGAAAAG GCTCATGAAGACTCGGAAAAGCTTC

GAGAGATCGTGTTGCCCATGGAGCAGGAGATTACCGAGCTGAAGGGGAAGCTGCAGAGGGCGGAAGAGCTGATCCAAGAGATCCAG AGACGACCACGGC

AGCCTGCCTCCCTGCATGGCTCCACAGAGTTGCTCCCTCTGTCGAGGAACCCCTCACCCCCACTGGAACCCTTGGAGGAGCCGAGCGGAGACGCCGGCCC

AGCCGCCGAGGCCTTTGCCCACAACTGCGATGACAGTGCCTCCATCTCTTCCTTCTCCCTCGGTGGGGCCGCCGGCAGTGCCTCCCTACGAGGCCCCCAA

GGCCTCAGCCCTGAGCAGGAAGAGACTGCTTCTCTGGTGTCTACTGGCACTCTGGTCCCTGAGGGCATCTTCCTGCCCCCTCCTGGGTACCAGCTTGTTC

CAGATAGCCAGTGGGAGCAACTGCAGGTAGAG - UNI36685 - GGGCGGCAGCTGCAGAAGGAGCTGGAAAGTGTCAGCCGGGAGCGGGATGAGCTG

CAGGAAGGACTAAGACGGAGCAATGAAGACTGTGCCAAGCAG ATGCAGGTGCTCCTGGCCCAGGTCCAGAACTCAGAGCAGCTGCTCCGAACTCTGCAA

GGAACTGTGAGCCAGGCCCAAGAGCGCGTGCAGCTGCAGATG - UNI36570 - GCAGAACTGGCCACTTCTCACAAGTGCCTGAGCCAAGAGGTTAA

AAGACTGAATGAAGAAAATCAAGGGCTCCGGGCTGAGCAGCTGCCATCCTCTGCCCTTCAGGGCTCAGAGCAGCGGGAGGACCAGGACGAGGCCCTGCCA

AGCTCCATACAG GAGCTACATCTGCTGGTGCAGAATACCAGGCAACAGGCGCGGGCCAGGCAGCAGGCACAGGAGCATGAGGCTGAGCGCCTGCGCATT

GAAATTGTGAAGCTGCGGGAGGCACTGGACGAGGAGACAGCAGCCAAGGCCAGTCTGGAGAGACAGCTGAGGGTGCAGCGAGAAGAGACAG ACGTGCTG

GAGG CCTCACTGTGCAGCCTGAGAATAGAGACGGAGCGGGTCCAGCAGGAGCAGCGCAAG GCCCAGCTCACGGATCTCCTCTCAGAGCAGAGAGCCAA

GACACTCCGGCTGCAGGCTGAGCTGGAGACCAGTGAACAGGTGCAGAGGGACTTTGTACGGCTGTCCCAGGCCCTACAG GTACGCCTGGAGCGGATCCG

CCAAGCAGAGACTCTGCAGCAAGTGCGTAGCATCCTGGATGAGGCGCCCCTCAGGGACATCAGGGACATTAAAGACTCTTGAGGGGCCAGGCGAGAGGCT

TCCCTGCTGGGGAAGCTGCCCCTTTCTCTACAAGAACTATGAGGCATGGACTGCAGGTCTCAGAACTGGAGTCCCATCAGCTGCAAACCTGGATGGTGGT

GTCCCTAGGGCCACTACTTCCACCCAGGGTGGCTGGGCCTGCCCTCAGGGATGATACCTGGAAAAGGGTCCCAGCCTCCTTCCAGAACCAAAGTGCAGGC

TGAGCCAGGTGGCTTTCGGGCTACCATGCTCCCTCATGGATCCAGCTCTCCCACCCTGTCACCTCAGGCCAGTAGCCAGTCCCAGTCTCTGGCACGCCCA

GCTTGTGGCTAGAAGCTGGTGGATTCAGTGGGCTCCTCGCACAGAGGCCCTGGGACATACAACTGCTTTCTGGACTGTACGACACTAAGGTATTTGTCCG

TAGGCACCTGAAACAGGCCCCAAGATATAAGGAAGCAAGGCCAGACTTTTCTGTCATTTATTTTCAATAAATAAGCAATCAGCT
Translation
 MKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKD - UNI14704 - DSISSYETQIAALKQERQQQQQDFEEKDRELGHLKQLLARAHPLDSLEK

QMEK AHEDSEKLREIVLPMEQEITELKGKLQRAEELIQEIQ RRPRQPASLHGSTELLPLSRNPSPPLEPLEEPSGDAGPAAEAFAHNCDDSASISSFS

LGGAAGSASLRGPQGLSPEQEETASLVSTGTLVPEGIFLPPPGYQLVPDSQWEQLQVE - UNI36685 - GRQLQKELESVSRERDELQEGLRRSNED

CAKQ MQVLLAQVQNSEQLLRTLQGTVSQAQERVQLQM - UNI36570 - AELATSHKCLSQEVKRLNEENQGLRAEQLPSSALQGSEQREDQDEALP

SSIQ ELHLLVQNTRQQARARQQAQEHEAERLRIEIVKLREALDEETAAKASLERQLRVQREETD DVLEA ASLCSLRIETERVQQEQRK AQLTDLLS

EQRAKTLRLQAELETSEQVQRDFVRLSQALQ VRLERIRQAETLQQVRSILDEAPLRDIRDIKDS
Transcript ENSMUST00000106405
Sequence
GGAATGGGATGAGGTCCTTGTAGATGGAGAGTAGGACTGGGTTACTGGACTGCTGGGTGGCCTGAGGTGTTAGGAGATCGGCAAGCCGTGGGAATAAATC

TTGGTCACTGTCCCCCCCACTCCCCGCTCCCCACAGCGCTGGATCCCCAGCCCCAAGAGAAGCAAAAGGATGCATCCGAGTCAAGTGAGCTCAGTCGGCT

TCGTGCCGAACTGGCCGGTGCCCTGGCAGAAATGGAAACCATGAAGGCTGTAGCTGAGGTGAGCGAGAGCACCAAGGCGGAGGCAGTGGCTGCAGTGCAG

AGACAGTGCCAAGAGGAGGTGGCCTCCCTGCAGGCCATCCTGAAAG - UNI14704 - ACTCCATCAGCAGCTACGAGACCCAGATCGCAGCCCTGAA

ACAGGAGCGGCAGCAGCAACAGCAGGACTTTGAGGAGAAGGATCGAGAGCTGGGCCACCTCAAACAGCTGCTGGCCCGGGCCCACCCTTTGGACTCCTTG

GAGAAGCAAATGGAAAAG GCTCATGAAGACTCGGAAAAGCTTCGAGAGATCGTGTTGCCCATGGAGCAGGAGATTACCGAGCTGAAGGGGAAGCTGCAG

AGGGCGGAAGAGCTGATCCAAGAGATCCAG AGACGACCACGGCAGCCTGCCTCCCTGCATGGCTCCACAGAGTTGCTCCCTCTGTCGAGGAACCCCTCA

CCCCCACTGGAACCCTTGGAGGAGCCGAGCGGAGACGCCGGCCCAGCCGCCGAGGCCTTTGCCCACAACTGCGATGACAGTGCCTCCATCTCTTCCTTCT

CCCTCGGTGGGGCCGCCGGCAGTGCCTCCCTACGAGGCCCCCAAGGCCTCAGCCCTGAGCAGGAAGAGACTGCTTCTCTGGTGTCTACTGGCACTCTGGT

CCCTGAGGGCATCTTCCTGCCCCCTCCTGGGTACCAGCTTGTTCCAGATAGCCAGTGGGAGCAACTGCAGGTAGAG - UNI36685 - GGGCGGCAGC

TGCAGAAGGAGCTGGAAAGTGTCAGCCGGGAGCGGGATGAGCTGCAGGAAGGACTAAGACGGAGCAATGAAGACTGTGCCAAGCAG ATGCAGGTGCTCC

TGGCCCAGGTCCAGAACTCAGAGCAGCTGCTCCGAACTCTGCAAGGAACTGTGAGCCAGGCCCAAGAGCGCGTGCAGCTGCAGATG - UNI36570 - 

GCAGAACTGGCCACTTCTCACAAGTGCCTGAGCCAAGAGGTTAAAAGACTGAATGAAGAAAATCAAGGGCTCCGGGCTGAGCAGCTGCCATCCTCTGCCC

TTCAGGGCTCAGAGCAGCGGGAGGACCAGGACGAGGCCCTGCCAAGCTCCATACAG GAGCTACATCTGCTGGTGCAGAATACCAGGCAACAGGCGCGGG

CCAGGCAGCAGGCACAGGAGCATGAGGCTGAGCGCCTGCGCATTGAAATTGTGAAGCTGCGGGAGGCACTGGACGAGGAGACAGCAGCCAAGGCCAGTCT

GGAGAGACAGCTGAGGGTGCAGCGAGAAGAGACAG ACGTGCTGGAGG CCTCACTGTGCAGCCTGAGAATAGAGACGGAGCGGGTCCAGCAGGAGCAGC

GCAAG GCCCAGCTCACGGATCTCCTCTCAGAGCAGAGAGCCAAGACACTCCGGCTGCAGGCTGAGCTGGAGACCAGTGAACAGGTGCAGAGGGACTTTG

TACGGCTGTCCCAGGCCCTACAG GTACGCCTGGAGCGGATCCGCCAAGCAGAGACTCTGCAGCAAGTGCGTAGCATCCTGGATGAGGCGCCCCTCAGGG

ACATCAGGGACATTAAAGACTCTTGAGGGGCCAGGCGAGAGGCTTCCCTGCTGGGGAAGCTGCCCCTTTCTCTACAAGAACTATGAGGCATGGACTGCAG

GTCTCAGAACTGGAGTCCCATCAGCTGCAAACCTGGATGGTGGTGTCCCTAGGGCCACTACTTCCACCCAGGGTGGCTGGGCCTGCCCTCAGGGATGATA

CCTGGAAAAGGGTCCCAGCCTCCTTCCAGAACCAAAGTGCAGGCTGAGCCAGGTGGCTTTCGGGCTACCATGCTCCCTCATGGATCCAGCTCTCCCACCC

TGTCACCTCAGGCCAGTAGCCAGTCCCAGTCTCTGGCACGCCCAGCTTGTGGCTAGAAGCTGGTGGATTCAGTGGGCTCCTCGCACAGAGGCCCTGGGAC

ATACAACTGCTTTCTGGACTGTACGACACTAAGGTATTTGTCCGTAGGCACCTGAAACAGGCCCCAAGATATAAGGAAGCAAGGCCAGACTTTTCTGTCA

TTTATTTTCAATAAATAAGCAATCAGCTA
Translation
MKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKD - UNI14704 - DSISSYETQIAALKQERQQQQQDFEEKDRELGHLKQLLARAHPLDSLEKQ

MEK AHEDSEKLREIVLPMEQEITELKGKLQRAEELIQEIQ RRPRQPASLHGSTELLPLSRNPSPPLEPLEEPSGDAGPAAEAFAHNCDDSASISSFSL

GGAAGSASLRGPQGLSPEQEETASLVSTGTLVPEGIFLPPPGYQLVPDSQWEQLQVE - UNI36685 - GRQLQKELESVSRERDELQEGLRRSNEDC

AKQ MQVLLAQVQNSEQLLRTLQGTVSQAQERVQLQM - UNI36570 - AELATSHKCLSQEVKRLNEENQGLRAEQLPSSALQGSEQREDQDEALPS

SIQ ELHLLVQNTRQQARARQQAQEHEAERLRIEIVKLREALDEETAAKASLERQLRVQREETD DVLEA ASLCSLRIETERVQQEQRK AQLTDLLSE

QRAKTLRLQAELETSEQVQRDFVRLSQALQ VRLERIRQAETLQQVRSILDEAPLRDIRDIKDS

For any suggestions or comments, please send an email to unitrap@crg.es