Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030766 (Arhgap17)
Chromosomal location
Chr 7: 130350805 - 130513405 (-)
Description
Rho GTPase activating protein 17 Gene [Source:MGI Symbol;Acc:MGI:1917747]
RefSeq_peptide
NP_653112.2 NP_001116112.1 NP_001116113.1 NP_001116114.1 NP_001116115.1 
MGI
MGI:1917747 
Uniprot/SWISSPROT
Q3UIA2 
Uniprot/SPTREMBL
Q3V425 
Human Ortholog
ENSG00000140750 (ARHGAP17)
Omim not available
UniTrap UNI927
Vector Insertion
Chr 7: 130474780 - 130513267
Public Clones (sanger) BC0263 (sanger) 3SM123E02 (ggtc) 5SD136F03 (ggtc) 5SE307D06 (ggtc)
5SD094A05 (ggtc) 5SD141D06 (ggtc) 3SD136F03 (ggtc) 5SE124E04 (ggtc)
3SD141D06 (ggtc) 3SD120D12 (ggtc) IST12690F1 (tigm) IST14171D5 (tigm)
IST12247F11 (tigm) IST14633F4 (tigm) IST12536G7 (tigm)
Private Clones OST134245 (lexicon) OST33228 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7737
Vector Insertion
Chr 7: 130470858 - 130474739
Public Clones RRN062 (baygenomics) CMHD-GT_461A7-3 (cmhd) CMHD-GT_425H9-3 (cmhd)
Private Clones OST240545 (lexicon) OST156075 (lexicon) OST115616 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38516
Vector Insertion
Chr 7: 130467126 - 130470858
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22449
Vector Insertion
Chr 7: 130465505 - 130467126
Public Clones CMHD-GT_524B1-3 (cmhd)
Private Clones OST296707 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8555
Vector Insertion
Chr 7: 130458010 - 130458157
Public Clones RRO321 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28234
Vector Insertion
Chr 7: 130444117 - 130447209
Public Clones not available
Private Clones OST36449 (lexicon)
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8365
Vector Insertion
Chr 7: 130430528 - 130435549
Public Clones XG138 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19389
Vector Insertion
Chr 7: 130423631 - 130428933
Public Clones IST10641D8 (tigm)
Private Clones OST392437 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15420
Vector Insertion
Chr 7: 130350804 - 130423631
Public Clones 3SD121B08 (ggtc) 3SD051E10 (ggtc) PST7319-NL (escells) IST13376D7 (tigm)
IST11916B1 (tigm) IST11987C3 (tigm) IST14764F12 (tigm) IST12801E5 (tigm)
IST10490F1 (tigm) IST14231C1 (tigm) IST10744F3 (tigm) IST12709A2 (tigm)
IST10852D9 (tigm) IST14495H12 (tigm) IST14963B12 (tigm) IST14193G4 (tigm)
IST14699D2 (tigm) IST10300G6 (tigm) IST10708F3 (tigm) IST12936F8 (tigm)
IST13863C3 (tigm) IST14927A4 (tigm) IST13511G3 (tigm) IST10580A4 (tigm)
IST10908D2 (tigm) IST12174C7 (tigm) IST13068F7 (tigm) IST12951F3 (tigm)
IST10850E11 (tigm) IST10251D4 (tigm) IST14914F12 (tigm) IST12608F4 (tigm)
IST12422B12 (tigm) IST10785G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106442
Sequence
GCCGGGAAGCGATGTAGGTAGGACCCGCCAGACGGTCCCCAGTTCTCCTCCGCCCGCCTGCCGCGCCGCCACCGCCGCCGCCGCCATGAAGAAGCAATTC

AACCGCATGAAGCAGCTGGCCAATCAGACTGTCGGCAG - UNI927 - AGCTGAGAAGACCGAAGTCCTCAGTGAAGATCTGCTACAG - UNI7737

 - ATTGAACGTCGCCTGGACACTGTGCGTTCAATGTGCCACCATTCACATAAGCGTTTGATAGCCTGCTTCCAAGGTCAGCATGGCACTGATGCCGAGA

GGAGACAT AAAAAGCTTCCTCTGACAGCTCTTGCCCAGAACATGCAGGAGGCTTCAGCCCAGCTGGAAGAGTCTCTCTTGGG - UNI22449 - GAA

GATGCTGGAGACCTGTGGGGACGCTGAGAACCAGCTGGCTCTTGAACTCTCACAACATGAAGTCTTTGTGGAGAAGGAGATCATGGACCCTCTCTACGGC

ATAGCAGAG GTGGAGATTCCCAATATCCAGAAGCAAAGGAAGCAGCTTGCTAGATTGGTGTTGGACTGGGATTCAGTCAGAGCGAG ATGGAACCAAGC

ACACAAGTCTTCAGGAACCAACTTTCAGGGGCTTCCATCCAAAATAGATACCCTAAAGGAAGAGATGGATGAAGCTGGGAATAAAGTTGAACAGTGCAAG

 GATCAACTTGCAGCAGACATGTACAACTTCATGGCCAAAGAAGGGGAGTATGGCAAGTTCTTCGTGACG - UNI8555 - TTATTAGAAGCCCAAGC

AGATTACCATAGAAAAGCATTAGCAGTCTTAGAAAAGGCCCTTCCCGAAATGCGCGCCCATCAAG ATAAGTGGGCAGAGAAGCCAGCCTTCGGCACACC

TCTGGAGGAACACCTGAAGAGGAGTGGGCGTGAGATCGCCCTGCCTATTGAGGCCTGTGTCATGTTGTTGCTGGAGACTGGCATGAAAGAGGAG GGCCT

TTTTCGGATTGGAGCTGGAGCCTCCAAGTTGAAGAAGCTGAAAGCTGCTCTCGACTGCTCCACATCGCATCTGGATGAATTCTATTCTGATCCCCATGCT

GTCGCAG GTGCTTTAAAGTCCTATCTGCGGGAGTTGCCTGAGCCCTTAATGACTTTCAGTCTGTATGAAGAATGGACACAAGTTGCAAG TGTGCAGGA

TCAAGACAAAAAACTTCAATATTTATGGACAACATGTCAGAAGTTGCCGCCACAAAATTTTGTTAACTTTAG - UNI28234 - GTATTTAATCAAGT

TCCTTGCAAAGCTTGCCCAGACCAGTGACGTTAATAAAATGACTCCTAGCAACATAGCCATTGTCCTGGGCCCTAACCTCCTGTGGGCCAAACAAGAAGG

 AACGCTGGCTGAAATAGCGGCTGCCACATCGGTCCACGTGGTTGCAGTGATTGAGCCCATCATCCAGCATGCAGATTGGTTCTTCCCTGGAG AGGTAG

AATTCAATGTATCAGAAGCATTTGTGCCACTTGCTACCCCGAATTCTAATCACTCATCCCATACTGGAAATGACTCTGACTCGGGGACTCTGGAGAGGAA

GCGACCTGCCAGCATGGCAGTGATGGAAGGGGACTTGGTGAAGAAGGAGAG CTTTGGTGTGAAGCTAATGGACTTCCAGGCCCACCGGCGGGGTGGCAC

TCTAAATAGAAAGCACATAGCCCCCGCTTTCCAGCCGCCACTCCCGCCCACGGATGGCAACGCCTTGGCTCCAGCAGGCCCAGAGCCCCCTTCTCAGAGC

TCTAGGGCTGACAGCAGCTCAGGGGGTGGGCCTGTCTTCTCTTCTACGGGCATATTGGAGCAGGGGCTGAGCCCAGGTGACAGCAG TCCTCCAAAACCC

AAAGACTCCGTGTCTGCAGCTGTCCCTGCAGCAGGAAGGAACAGCAACCAGATGACCACGGTCCCAAACCAGGCTCAGACAGGTGGCAACTCCCATCAGC

TCTCAGTAAGCACACCTCACAGTGCAGCCGGTCCCAGCCCGCACACTCTGCGTCGGG - UNI8365 - CTGTGAAGAAACCTGCCCCCGCACCCCCCA

AACCAGGAAACCTACCTCCTGGCCACCCTGGAGGACAGAGCTCTCCTGGCACAGGCACATCCCCAAAGCCAAGCGCCCGAAGCCCATCACCGCCTCAGCA

GCAGCAGCAGCAGCAACAACAGCAGCAACAACAGCAGCAGCAGCAGACCCCAGGCATGCGCCGCTGCTCCAGCAGCCTGCCTCCCATCCAGGCACCCAGC

CACCCACCACCACAGCCCCCCACACAGCCTCGGTTGGGTGAACAGGGACCAGAGCCAGGCCCCACGCCACCTCAAACCCCCACACCACCTAGCACCCCAC

CCCTGGCCAAGCAGAATCCATCGCAAAGTGAGACCACACAGCTGCACGGAACCCTCCCAAGACCACGGCCAGTGCCCAAGCCCCGCAACCGGCCTAGCGT

GCCACCACCCCCACATCCACCTGGCACCCACACGGTGGATGGTGGCCTTACATCCTCAGTGCCCACAGCCTCCAGAATCGTCACTG - UNI15420 - 

- UNI19389 - ACACCAATTCTAGGGTTTCTGAATCACTTCGCAGCATCTTTCCTGAAATACATTCAGACTTGGCAAGCAAAGAAGTGCCTGGCCACA

TCCTGCTGGACATAGACAATGACACAGAAAGTACTGCATTGTGAAGAAAGCCACTTGTCAGCCTTTGGCCCTCCATCCCAGTGAACGGAACTGGGTCAGG

CAAGCCTCTGTCTCTGCAGACCAAACAGTGAGAAGCTTTTAGTGGGGGAAGGAAGGTCTGACTACGAAGGACTAGACTCCCACGGCCCAAGGAGAAGGTG

AGGGCCAGTCCTCAAAGCTGAATGACCTGTGTCGTAAAGAAGTTGGCTTGCTTTATCTAGGATGAAAATCATGCCAAAAATGATCAGGACAAAGAAATAC

CGACAGCAGGAGTATTACTGCTGAGAGGTGTATGGGAAGCTGTTGCCAGAGCTGTCAGCTCAGACAGCTCTGATTGTGACTAAGAAGAGACTTACCTATC

TATTTAATAAAACATTAATTATGCAAGTTGCCTACTTCCTGCTACTTGGACTTTGGTTCTCACATACCAGAAGGAGCTTCCATTCCTTCAGACTTGCTGC

AGAATCATTTTGTATTAAATAGTCTGTCTCCTCCAACCCCCAGAACCTCGAGCATTGGCGACTGCTGGCTCTGTCGCCTCAGCAGAATGGATGCAAGTCG

TGCCTTGTGGATTGCCAGAATATGGAGAGAAATATACCGTTCTTTTTAAAAAAAAAAACAAAACAAAACAAAACTATAATTGCTACTTGATAAAGAGCGA

ATGTTATTCTAGTTTCATGTTTAATTTGAATTAAATATATTCTGTGGTTTATATGAAAA - UNI15420 - AAAAAAAAAAAAAG
Translation
PGSDVGRTRQTVPSSPPPACRAATAAAAMKKQFNRMKQLANQTVGR - UNI927 - RAEKTEVLSEDLLQ - UNI7737 - IERRLDTVRSMCHHS

HKRLIACFQGQHGTDAERRH KKLPLTALAQNMQEASAQLEESLLG - UNI22449 - GKMLETCGDAENQLALELSQHEVFVEKEIMDPLYGIAE V

EIPNIQKQRKQLARLVLDWDSVRAR RWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCK DQLAADMYNFMAKEGEYGKFFVT - UNI8555 -

 LLEAQADYHRKALAVLEKALPEMRAHQD DKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEE GLFRIGAGASKLKKLKAALDCSTSHL

DEFYSDPHAVAG GALKSYLRELPEPLMTFSLYEEWTQVAS SVQDQDKKLQYLWTTCQKLPPQNFVNFR - UNI28234 - RYLIKFLAKLAQTSDV

NKMTPSNIAIVLGPNLLWAKQEG GTLAEIAAATSVHVVAVIEPIIQHADWFFPGE EVEFNVSEAFVPLATPNSNHSSHTGNDSDSGTLERKRPASMAV

MEGDLVKKES SFGVKLMDFQAHRRGGTLNRKHIAPAFQPPLPPTDGNALAPAGPEPPSQSSRADSSSGGGPVFSSTGILEQGLSPGDSS SPPKPKDSV

SAAVPAAGRNSNQMTTVPNQAQTGGNSHQLSVSTPHSAAGPSPHTLRRA - UNI8365 - AVKKPAPAPPKPGNLPPGHPGGQSSPGTGTSPKPSARS

PSPPQQQQQQQQQQQQQQQQQTPGMRRCSSSLPPIQAPSHPPPQPPTQPRLGEQGPEPGPTPPQTPTPPSTPPLAKQNPSQSETTQLHGTLPRPRPVPKP

RNRPSVPPPPHPPGTHTVDGGLTSSVPTASRIVTD - UNI15420 - - UNI19389 - DTNSRVSESLRSIFPEIHSDLASKEVPGHILLDIDNDT

ESTAL - UNI15420 - 
Transcript ENSMUST00000098060
Sequence
GTAGGTAGGACCCGCCAGACGGTCCCCAGTTCTCCTCCGCCCGCCTGCCGCGCCGCCACCGCCGCCGCCGCCATGAAGAAGCAATTCAACCGCATGAAGC

AGCTGGCCAATCAGACTGTCGGCAG - UNI927 - AGCTGAGAAGACCGAAGTCCTCAGTGAAGATCTGCTACAG - UNI7737 - ATTGAACGTC

GCCTGGACACTGTGCGTTCAATGTGCCACCATTCACATAAGCGTTTGATAGCCTGCTTCCAAGGTCAGCATGGCACTGATGCCGAGAGGAGACAT AAAA

AGCTTCCTCTGACAGCTCTTGCCCAGAACATGCAGGAGGCTTCAGCCCAGCTGGAAGAGTCTCTCTTGGG - UNI22449 - GAAGATGCTGGAGACC

TGTGGGGACGCTGAGAACCAGCTGGCTCTTGAACTCTCACAACATGAAGTCTTTGTGGAGAAGGAGATCATGGACCCTCTCTACGGCATAGCAGAG GTG

GAGATTCCCAATATCCAGAAGCAAAGGAAGCAGCTTGCTAGATTGGTGTTGGACTGGGATTCAGTCAGAGCGAG ATGGAACCAAGCACACAAGTCTTCA

GGAACCAACTTTCAGGGGCTTCCATCCAAAATAGATACCCTAAAGGAAGAGATGGATGAAGCTGGGAATAAAGTTGAACAGTGCAAG GATCAACTTGCA

GCAGACATGTACAACTTCATGGCCAAAGAAGGGGAGTATGGCAAGTTCTTCGTGACG - UNI8555 - TTATTAGAAGCCCAAGCAGATTACCATAGA

AAAGCATTAGCAGTCTTAGAAAAGGCCCTTCCCGAAATGCGCGCCCATCAAG ATAAGTGGGCAGAGAAGCCAGCCTTCGGCACACCTCTGGAGGAACAC

CTGAAGAGGAGTGGGCGTGAGATCGCCCTGCCTATTGAGGCCTGTGTCATGTTGTTGCTGGAGACTGGCATGAAAGAGGAG GGCCTTTTTCGGATTGGA

GCTGGAGCCTCCAAGTTGAAGAAGCTGAAAGCTGCTCTCGACTGCTCCACATCGCATCTGGATGAATTCTATTCTGATCCCCATGCTGTCGCAG GTGCT

TTAAAGTCCTATCTGCGGGAGTTGCCTGAGCCCTTAATGACTTTCAGTCTGTATGAAGAATGGACACAAGTTGCAAG TGTGCAGGATCAAGACAAAAAA

CTTCAATATTTATGGACAACATGTCAGAAGTTGCCGCCACAAAATTTTGTTAACTTTAG - UNI28234 - GTATTTAATCAAGTTCCTTGCAAAGCT

TGCCCAGACCAGTGACGTTAATAAAATGACTCCTAGCAACATAGCCATTGTCCTGGGCCCTAACCTCCTGTGGGCCAAACAAGAAGG AACGCTGGCTGA

AATAGCGGCTGCCACATCGGTCCACGTGGTTGCAGTGATTGAGCCCATCATCCAGCATGCAGATTGGTTCTTCCCTGGAG AGGTAGAATTCAATGTATC

AGAAGCATTTGTGCCACTTGCTACCCCGAATTCTAATCACTCATCCCATACTGGAAATGACTCTGACTCGGGGACTCTGGAGAGGAAGCGACCTGCCAGC

ATGGCAGTGATGGAAGGGGACTTGGTGAAGAAGGAGAG TCCTCCAAAACCCAAAGACTCCGTGTCTGCAGCTGTCCCTGCAGCAGGAAGGAACAGCAAC

CAGATGACCACGGTCCCAAACCAGGCTCAGACAGGTGGCAACTCCCATCAGCTCTCAGTAAGCACACCTCACAGTGCAGCCGGTCCCAGCCCGCACACTC

TGCGTCGGG - UNI8365 - CTGTGAAGAAACCTGCCCCCGCACCCCCCAAACCAGGAAACCTACCTCCTGGCCACCCTGGAGGACAGAGCTCTCCTG

GCACAGGCACATCCCCAAAGCCAAGCGCCCGAAGCCCATCACCGCCTCAGCAGCAGCAGCAGCAGCAACAACAGCAGCAACAACAGCAGCAGCAGCAGAC

CCCAGGCATGCGCCGCTGCTCCAGCAGCCTGCCTCCCATCCAGGCACCCAGCCACCCACCACCACAGCCCCCCACACAGCCTCGGTTGGGTGAACAGGGA

CCAGAGCCAGGCCCCACGCCACCTCAAACCCCCACACCACCTAGCACCCCACCCCTGGCCAAGCAGAATCCATCGCAAAGTGAGACCACACAGCTGCACG

GAACCCTCCCAAGACCACGGCCAGTGCCCAAGCCCCGCAACCGGCCTAGCGTGCCACCACCCCCACATCCACCTGGCACCCACACGGTGGATGGTGGCCT

TACATCCTCAGTGCCCACAGCCTCCAGAATCGTCACTG ATGCCCTTCCCGGTGCCCTCACAGGTGGGGAAGGTTTCCAGAACTAAG - UNI15420 -

 - UNI19389 - ACACCAATTCTAGGGTTTCTGAATCACTTCGCAGCATCTTTCCTGAAATACATTCAGACTTGGCAAGCAAAGAAGTGCCTGGCCAC

ATCCTGCTGGACATAGACAATGACACAGAAAGTACTGCATTGTGAAGAAAGCCACTTGTCAGCCTTTGGCCCTCCATCCCAGTGAACGGAACTGGGTCAG

GCAAGCCTCTGTCTCTGCAGACCAAACAGTGAGAAGCTTTTAGTGGGGGAAGGAAGGTCTGACTACGAAGGACTAGACTCCCACGGCCCAAGGAGAAGGT

GAGGGCCAGTCCTCAAAGCTGAATGACCTGTGTCGTAAAGAAGTTGGCTTGCTTTATCTAGGATGAAAATCATGCCAAAAATGATCAGGACAAAGAAATA

CCGACAGCAGGAGTATTACTGCTGAGAGGTGTATGGGAAGCTGTTGCCAGAGCTGTCAGCTCAGACAGCTCTGATTGTGACTAAGAAGAGACTTACCTAT

CTATTTAATAAAACATTAATTATGCAAGTTGCCTACTTCCTGCTACTTGGACTTTGGTTCTCACATACCAGAAGGAGCTTCCATTCCTTCAGACTTGCTG

CAGAATCATTTTGTATTAAATAGTCTGTCTCCTCCAACCCCCAGAACCTCGAGCATTGGCGACTGCTGGCTCTGTCGCCTCAGCAGAATGGATGCAAGTC

GTGCCTTGTGGATTGCCAGAATATGGAGAGAAATATACCGTTCTTTTTAAAAAAAAAAACAAAACAAAACAAAACTATAATTGCTACTTGATAAAGAGCG

AATGTTATTCTAGTTTCATGTTTAATTTGAATTAAATATATTCTGTGGTTTATATG
Translation
MKKQFNRMKQLANQTVGR - UNI927 - RAEKTEVLSEDLLQ - UNI7737 - IERRLDTVRSMCHHSHKRLIACFQGQHGTDAERRH KKLPLTA

LAQNMQEASAQLEESLLG - UNI22449 - GKMLETCGDAENQLALELSQHEVFVEKEIMDPLYGIAE VEIPNIQKQRKQLARLVLDWDSVRAR RW

NQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCK DQLAADMYNFMAKEGEYGKFFVT - UNI8555 - LLEAQADYHRKALAVLEKALPEMRAHQ

D DKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEE GLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAG GALKSYLRELPEPLM

TFSLYEEWTQVAS SVQDQDKKLQYLWTTCQKLPPQNFVNFR - UNI28234 - RYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKQEG GTLA

EIAAATSVHVVAVIEPIIQHADWFFPGE EVEFNVSEAFVPLATPNSNHSSHTGNDSDSGTLERKRPASMAVMEGDLVKKES SPPKPKDSVSAAVPAAG

RNSNQMTTVPNQAQTGGNSHQLSVSTPHSAAGPSPHTLRRA - UNI8365 - AVKKPAPAPPKPGNLPPGHPGGQSSPGTGTSPKPSARSPSPPQQQQ

QQQQQQQQQQQQQTPGMRRCSSSLPPIQAPSHPPPQPPTQPRLGEQGPEPGPTPPQTPTPPSTPPLAKQNPSQSETTQLHGTLPRPRPVPKPRNRPSVPP

PPHPPGTHTVDGGLTSSVPTASRIVTD DALPGALTGGEGFQN - UNI15420 - - UNI19389 - 
Transcript ENSMUST00000010403
Sequence
GTAGGTAGGACCCGCCAGACGGTCCCCAGTTCTCCTCCGCCCGCCTGCCGCGCCGCCACCGCCGCCGCCGCCATGAAGAAGCAATTCAACCGCATGAAGC

AGCTGGCCAATCAGACTGTCGGCAG - UNI927 - AGCTGAGAAGACCGAAGTCCTCAGTGAAGATCTGCTACAG - UNI7737 - ATTGAACGTC

GCCTGGACACTGTGCGTTCAATGTGCCACCATTCACATAAGCGTTTGATAGCCTGCTTCCAAGGTCAGCATGGCACTGATGCCGAGAGGAGACAT AAAA

AGCTTCCTCTGACAGCTCTTGCCCAGAACATGCAGGAGGCTTCAGCCCAGCTGGAAGAGTCTCTCTTGGG - UNI22449 - GAAGATGCTGGAGACC

TGTGGGGACGCTGAGAACCAGCTGGCTCTTGAACTCTCACAACATGAAGTCTTTGTGGAGAAGGAGATCATGGACCCTCTCTACGGCATAGCAGAG GTG

GAGATTCCCAATATCCAGAAGCAAAGGAAGCAGCTTGCTAGATTGGTGTTGGACTGGGATTCAGTCAGAGCGAG ATGGAACCAAGCACACAAGTCTTCA

GGAACCAACTTTCAGGGGCTTCCATCCAAAATAGATACCCTAAAGGAAGAGATGGATGAAGCTGGGAATAAAGTTGAACAGTGCAAG GATCAACTTGCA

GCAGACATGTACAACTTCATGGCCAAAGAAGGGGAGTATGGCAAGTTCTTCGTGACG - UNI8555 - TTATTAGAAGCCCAAGCAGATTACCATAGA

AAAGCATTAGCAGTCTTAGAAAAGGCCCTTCCCGAAATGCGCGCCCATCAAG ATAAGTGGGCAGAGAAGCCAGCCTTCGGCACACCTCTGGAGGAACAC

CTGAAGAGGAGTGGGCGTGAGATCGCCCTGCCTATTGAGGCCTGTGTCATGTTGTTGCTGGAGACTGGCATGAAAGAGGAG GGCCTTTTTCGGATTGGA

GCTGGAGCCTCCAAGTTGAAGAAGCTGAAAGCTGCTCTCGACTGCTCCACATCGCATCTGGATGAATTCTATTCTGATCCCCATGCTGTCGCAG GTGCT

TTAAAGTCCTATCTGCGGGAGTTGCCTGAGCCCTTAATGACTTTCAGTCTGTATGAAGAATGGACACAAGTTGCAAG TGTGCAGGATCAAGACAAAAAA

CTTCAATATTTATGGACAACATGTCAGAAGTTGCCGCCACAAAATTTTGTTAACTTTAG - UNI28234 - GTATTTAATCAAGTTCCTTGCAAAGCT

TGCCCAGACCAGTGACGTTAATAAAATGACTCCTAGCAACATAGCCATTGTCCTGGGCCCTAACCTCCTGTGGGCCAAACAAGAAGG AACGCTGGCTGA

AATAGCGGCTGCCACATCGGTCCACGTGGTTGCAGTGATTGAGCCCATCATCCAGCATGCAGATTGGTTCTTCCCTGGAG AGGTAGAATTCAATGTATC

AGAAGCATTTGTGCCACTTGCTACCCCGAATTCTAATCACTCATCCCATACTGGAAATGACTCTGACTCGGGGACTCTGGAGAGGAAGCGACCTGCCAGC

ATGGCAGTGATGGAAGGGGACTTGGTGAAGAAGGAGAG TCCTCCAAAACCCAAAGACTCCGTGTCTGCAGCTGTCCCTGCAGCAGGAAGGAACAGCAAC

CAGATGACCACGGTCCCAAACCAGGCTCAGACAGGTGGCAACTCCCATCAGCTCTCAGTAAGCACACCTCACAGTGCAGCCGGTCCCAGCCCGCACACTC

TGCGTCGGG - UNI8365 - CTGTGAAGAAACCTGCCCCCGCACCCCCCAAACCAGGAAACCTACCTCCTGGCCACCCTGGAGGACAGAGCTCTCCTG

GCACAGGCACATCCCCAAAGCCAAGCGCCCGAAGCCCATCACCGCCTCAGCAGCAGCAGCAGCAGCAACAACAGCAGCAACAACAGCAGCAGCAGCAGAC

CCCAGGCATGCGCCGCTGCTCCAGCAGCCTGCCTCCCATCCAGGCACCCAGCCACCCACCACCACAGCCCCCCACACAGCCTCGGTTGGGTGAACAGGGA

CCAGAGCCAGGCCCCACGCCACCTCAAACCCCCACACCACCTAGCACCCCACCCCTGGCCAAGCAGAATCCATCGCAAAGTGAGACCACACAGCTGCACG

GAACCCTCCCAAGACCACGGCCAGTGCCCAAGCCCCGCAACCGGCCTAGCGTGCCACCACCCCCACATCCACCTGGCACCCACACGGTGGATGGTGGCCT

TACATCCTCAGTGCCCACAGCCTCCAGAATCGTCACTG GTGTA
Translation
MKKQFNRMKQLANQTVGR - UNI927 - RAEKTEVLSEDLLQ - UNI7737 - IERRLDTVRSMCHHSHKRLIACFQGQHGTDAERRH KKLPLTA

LAQNMQEASAQLEESLLG - UNI22449 - GKMLETCGDAENQLALELSQHEVFVEKEIMDPLYGIAE VEIPNIQKQRKQLARLVLDWDSVRAR RW

NQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCK DQLAADMYNFMAKEGEYGKFFVT - UNI8555 - LLEAQADYHRKALAVLEKALPEMRAHQ

D DKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEE GLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAG GALKSYLRELPEPLM

TFSLYEEWTQVAS SVQDQDKKLQYLWTTCQKLPPQNFVNFR - UNI28234 - RYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKQEG GTLA

EIAAATSVHVVAVIEPIIQHADWFFPGE EVEFNVSEAFVPLATPNSNHSSHTGNDSDSGTLERKRPASMAVMEGDLVKKES SPPKPKDSVSAAVPAAG

RNSNQMTTVPNQAQTGGNSHQLSVSTPHSAAGPSPHTLRRA - UNI8365 - AVKKPAPAPPKPGNLPPGHPGGQSSPGTGTSPKPSARSPSPPQQQQ

QQQQQQQQQQQQQTPGMRRCSSSLPPIQAPSHPPPQPPTQPRLGEQGPEPGPTPPQTPTPPSTPPLAKQNPSQSETTQLHGTLPRPRPVPKPRNRPSVPP

PPHPPGTHTVDGGLTSSVPTASRIVTG GV
Transcript ENSMUST00000018324
Sequence
GTAGGTAGGACCCGCCAGACGGTCCCCAGTTCTCCTCCGCCCGCCTGCCGCGCCGCCACCGCCGCCGCCGCCATGAAGAAGCAATTCAACCGCATGAAGC

AGCTGGCCAATCAGACTGTCGGCAG - UNI927 - AGCTGAGAAGACCGAAGTCCTCAGTGAAGATCTGCTACAG - UNI7737 - ATTGAACGTC

GCCTGGACACTGTGCGTTCAATGTGCCACCATTCACATAAGCGTTTGATAGCCTGCTTCCAAGGTCAGCATGGCACTGATGCCGAGAGGAGACAT AAAA

AGCTTCCTCTGACAGCTCTTGCCCAGAACATGCAGGAGGCTTCAGCCCAGCTGGAAGAGTCTCTCTTGGG - UNI22449 - GAAGATGCTGGAGACC

TGTGGGGACGCTGAGAACCAGCTGGCTCTTGAACTCTCACAACATGAAGTCTTTGTGGAGAAGGAGATCATGGACCCTCTCTACGGCATAGCAGAG GTG

GAGATTCCCAATATCCAGAAGCAAAGGAAGCAGCTTGCTAGATTGGTGTTGGACTGGGATTCAGTCAGAGCGAG ATGGAACCAAGCACACAAGTCTTCA

GGAACCAACTTTCAGGGGCTTCCATCCAAAATAGATACCCTAAAGGAAGAGATGGATGAAGCTGGGAATAAAGTTGAACAGTGCAAG GATCAACTTGCA

GCAGACATGTACAACTTCATGGCCAAAGAAGGGGAGTATGGCAAGTTCTTCGTGACG - UNI8555 - TTATTAGAAGCCCAAGCAGATTACCATAGA

AAAGCATTAGCAGTCTTAGAAAAGGCCCTTCCCGAAATGCGCGCCCATCAAG ATAAGTGGGCAGAGAAGCCAGCCTTCGGCACACCTCTGGAGGAACAC

CTGAAGAGGAGTGGGCGTGAGATCGCCCTGCCTATTGAGGCCTGTGTCATGTTGTTGCTGGAGACTGGCATGAAAGAGGAG GGCCTTTTTCGGATTGGA

GCTGGAGCCTCCAAGTTGAAGAAGCTGAAAGCTGCTCTCGACTGCTCCACATCGCATCTGGATGAATTCTATTCTGATCCCCATGCTGTCGCAG GTGCT

TTAAAGTCCTATCTGCGGGAGTTGCCTGAGCCCTTAATGACTTTCAGTCTGTATGAAGAATGGACACAAGTTGCAAG TGTGCAGGATCAAGACAAAAAA

CTTCAATATTTATGGACAACATGTCAGAAGTTGCCGCCACAAAATTTTGTTAACTTTAG - UNI28234 - GTATTTAATCAAGTTCCTTGCAAAGCT

TGCCCAGACCAGTGACGTTAATAAAATGACTCCTAGCAACATAGCCATTGTCCTGGGCCCTAACCTCCTGTGGGCCAAACAAGAAGG AACGCTGGCTGA

AATAGCGGCTGCCACATCGGTCCACGTGGTTGCAGTGATTGAGCCCATCATCCAGCATGCAGATTGGTTCTTCCCTGGAG AGGTAGAATTCAATGTATC

AGAAGCATTTGTGCCACTTGCTACCCCGAATTCTAATCACTCATCCCATACTGGAAATGACTCTGACTCGGGGACTCTGGAGAGGAAGCGACCTGCCAGC

ATGGCAGTGATGGAAGGGGACTTGGTGAAGAAGGAGAG CTTTGGTGTGAAGCTAATGGACTTCCAGGCCCACCGGCGGGGTGGCACTCTAAATAGAAAG

CACATAGCCCCCGCTTTCCAGCCGCCACTCCCGCCCACGGATGGCAACGCCTTGGCTCCAGCAGGCCCAGAGCCCCCTTCTCAGAGCTCTAGGGCTGACA

GCAGCTCAGGGGGTGGGCCTGTCTTCTCTTCTACGGGCATATTGGAGCAGGGGCTGAGCCCAGGTGACAGCAG TCCTCCAAAACCCAAAGACTCCGTGT

CTGCAGCTGTCCCTGCAGCAGGAAGGAACAGCAACCAGATGACCACGGTCCCAAACCAGGCTCAGACAGGTGGCAACTCCCATCAGCTCTCAGTAAGCAC

ACCTCACAGTGCAGCCGGTCCCAGCCCGCACACTCTGCGTCGGG - UNI8365 - CTGTGAAGAAACCTGCCCCCGCACCCCCCAAACCAGGAAACCT

ACCTCCTGGCCACCCTGGAGGACAGAGCTCTCCTGGCACAGGCACATCCCCAAAGCCAAGCGCCCGAAGCCCATCACCGCCTCAGCAGCAGCAGCAGCAG

CAACAACAGCAGCAACAACAGCAGCAGCAGCAGACCCCAGGCATGCGCCGCTGCTCCAGCAGCCTGCCTCCCATCCAGGCACCCAGCCACCCACCACCAC

AGCCCCCCACACAGCCTCGGTTGGGTGAACAGGGACCAGAGCCAGGCCCCACGCCACCTCAAACCCCCACACCACCTAGCACCCCACCCCTGGCCAAGCA

GAATCCATCGCAAAGTGAGACCACACAGCTGCACGGAACCCTCCCAAGACCACGG CAGTGCCCAAGCCCCGCAACCGGCCTAGCGTGC CCACCCCCAC

ATCCACCTGGCACCCACACGGTGGATGGTGGCCTTACATCCTCAGTGCCCACAGCCTCCAGAATCGTCACT
Translation
MKKQFNRMKQLANQTVGR - UNI927 - RAEKTEVLSEDLLQ - UNI7737 - IERRLDTVRSMCHHSHKRLIACFQGQHGTDAERRH KKLPLTA

LAQNMQEASAQLEESLLG - UNI22449 - GKMLETCGDAENQLALELSQHEVFVEKEIMDPLYGIAE VEIPNIQKQRKQLARLVLDWDSVRAR RW

NQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCK DQLAADMYNFMAKEGEYGKFFVT - UNI8555 - LLEAQADYHRKALAVLEKALPEMRAHQ

D DKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEE GLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAG GALKSYLRELPEPLM

TFSLYEEWTQVAS SVQDQDKKLQYLWTTCQKLPPQNFVNFR - UNI28234 - RYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKQEG GTLA

EIAAATSVHVVAVIEPIIQHADWFFPGE EVEFNVSEAFVPLATPNSNHSSHTGNDSDSGTLERKRPASMAVMEGDLVKKES SFGVKLMDFQAHRRGGT

LNRKHIAPAFQPPLPPTDGNALAPAGPEPPSQSSRADSSSGGGPVFSSTGILEQGLSPGDSS SPPKPKDSVSAAVPAAGRNSNQMTTVPNQAQTGGNSH

QLSVSTPHSAAGPSPHTLRRA - UNI8365 - AVKKPAPAPPKPGNLPPGHPGGQSSPGTGTSPKPSARSPSPPQQQQQQQQQQQQQQQQQTPGMRRC

SSSLPPIQAPSHPPPQPPTQPRLGEQGPEPGPTPPQTPTPPSTPPLAKQNPSQSETTQLHGTLPRPR QCPSPATGLAC PPPHPPGTHTVDGGLTSSVP

TASRIVT

For any suggestions or comments, please send an email to unitrap@crg.es