Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030770 (Parva)
Chromosomal location
Chr 7: 119571019 - 119735202 (+)
Description
parvin, alpha Gene [Source:MGI (curated);Acc:Parva-001]
RefSeq_dna
NM_020606 
RefSeq_peptide
NP_065631.3 
MGI
MGI:1931144 
Uniprot/SWISSPROT
Q9EPC1 
Uniprot/SPTREMBL
Q8C5R4 Q3UF75 
Human Ortholog
ENSG00000197702 (PARVA)
Omim not available
UniTrap UNI31655
Vector Insertion
Chr 7: 119571615 - 119663214
Public Clones IST13007A9 (tigm) IST11043B1 (tigm) IST14069E9 (tigm) IST14069E10 (tigm)
IST12805E1 (tigm) IST13533H9 (tigm) IST11847D3 (tigm) IST10426H7 (tigm)
IST12296G9 (tigm) IST14571C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25474
Vector Insertion
Chr 7: 119663343 - 119687690
Public Clones IST12712H1 (tigm)
Private Clones OST182593 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033030
Sequence
CTTGCCCCTGCGTCTATAGCCCCCAGCAAGCGGCAAGCCAGGGCATCCTCGTAGCCAGGGCAGCCCTGGGCACGGGGGCCCCAGGCGCAGCAGCTCCTCG

CAGGGCGGAGGGCGGCGCGAGGGAGGGAGCGAGGGACGGGAAAGGCGAGCGAGCTGCCTCAAATGCCTGGAATAATTCCGCTTCCGTTTGGAAAGCCGCA

GCCTCAGTCCCGCCGCCGCCCGCCGCGGCCGCCCAGCTCCAGCTCCGCGTCCAGCCGCCATGGCCACATCCCCACAGAAGTCGCCCTTGGTCCCCAAATC

ACCCACTCCCAAGTCGCCTCCGTCCCGCAAGAAGGATGACTCGTTCTTGGGGAAACTCGGAGGGACGCTGGCCCGGAGGAAGAAAGCCAAAGAAG - UN

I25474 - - UNI31655 - TATCCGAGTTCCAGGAGGAAGGAATGAACGCCATCAACCTGCCTCTTAGCCCCATCTCCTTCGAGCTGGACCCCGAGG

ACACTCTGCTGG AGGAGAATGAGGTCCGGACAATGGTCGATCCAAACTCACGCAATGACCCCAAACTTCAAGAGCTGATGAAG GTGCTCATCGACTGG

ATCAATGACGTATTGGTGGGAGAAAGAATCATCGTGAAGGACCTCGCTGAAGATCTCTATGATGGCCAAGTCCTACAGAAGCTCTTCG AGAAACTGGAG

AGTGAGAAGCTCAACGTGGCCGAGGTTACGCAGTCGGAGATCGCCCAGAAACAGAAGCTACAGACTGTGCTGGAGAAGATCAATGAGACCCTGAAGCTTC

CTCCCAGGAGCATCAAGTGGAACGTGGACT CTGTTCATGCCAAGAACCTGGTTGCCATCCTCCACCTGCTGGTTGCTCTGTCTCAATATTTCCGGGCAC

CCATCCGACTCCCAGACCATGTTTCCATCCAAGTGGTTGTGGTCCAG AAACGAGAAGGGATCCTCCAGTCTCGACAAATCCAAGAGGAAATAACTGGTA

ACACAGA GGCCCTTTCCGGAAGGCATG AACGTGATGCCTTTGACACGCTGTTTGACCATGCACCAGACAAACTCAATGTGGTGAAGAAG ACCCTCAT

CACGTTCGTGAACAAGCATCTGAATAAACTGAACTTGGAGGTCACAGAACTGGAGACACAG TTTGCAGATGGGGTTTACCTGGTGTTGCTCATGGGGCT

CCTGGAAGGCTACTTTGTACCCCTGCACAGCTTCTTCCTGACCCCAGACAGCTTTGAACAGAAG GTCCTGAATGTCTCCTTTGCCTTTGAGCTCATGCA

AGATGGAGGGCTGGAAAAGCCTAAACCGCGGCCAGAAG ACATTGTCAACTGTGACCTGAAGTCCACGCTGAGAGTGCTATACAACCTCTTCACCAAGTA

CCGGAATGTGGAGTGAGACCCTGGGCTGCCTCCTGCTGCCCAGCCACTCTTCGTGAAGGCCATCTGGACCAGCTTCCCAACAGCCTTGCCCTGCTTGCTC

CTGTCTCTTGTTCCACCCTCTCCCACAAGCCCAGCAACCACCCAGAGATAGTGGACATTAAAATCAGTAAGGAAGTGACCACTAACCCAGTGAACTAATA

ACATCTGTAGGCTCTGGGGACTGAACCAGCAATGTCTTGGGAAATTGTCTCCATCCAAATTCAGGCCCTAGAGGTTCCTACATGTGCTGTGGGGATCAAC

ACAGCCCAGAGACAGTCCCCCTGAACATAGGAATAAAGATCAGAATTAGTCCCCACAATAAGGGGGAGTCTCTACCGTGCTCAAGTTCATTAGGTTTATG

TCTTATTAAAGGAGATCATTCCTCCCTGTTGTAGATGAAGAAACTGAGGCCCAGAGATGCGAAGGTTTGCTATCCATTAGCATGTATTCTCTGGGTGACT

TACTGGTTTATGACTGGTCAACTGCATTCCATTCTGTGTGTGTCCTAAAATGTGTGCATGCTTGTTCAGACCAGCCTTACCTGCATATACCTGTGTCCTC

TAGCAGACAAGACACTCTGATCTCACCCTAGGGCAGGCCAGGTCAGGGCTGGGTGATTCTCACTAAAATTGCCAAATTGAATTTAACTCTATTAATACTG

TGTGTGGCAGGAGCCTCATCCCTCAAATCCTTTGTACAAATGAAAATTACCCTTAATTCCTTCAGATTGGTAATAAGCCCACGCTCCGGTTGCAAGATGA

CATTTGGGAAGCGTTCTGTTTGGAATTAATAGAGTGCCCATTTCGCAGCCTTTTTGCTTGATTGCATGTAATGGATGTGCCCTATATTTTCCTGCAAAAT

AAGTACTCAATTCATTATCGTTAGGCAAATGTAGGGTATGCTTGCACATGGCAAAGAGCTGGGTGCAGACCCACTGGAGCATCGCCTGAGAAGTAGGGCT

CGTCAACAGAGACCCTTGAACTTTGAGGGAAAAAGAAAAAGAACCTCCTTTTTGCCTTCTAATTGGTCATTTAGGCCGTTCTGGCTAAGTCTGCCCACAT

GCAATTACTGGCTAATTCCAGGCGTGGAGAATGTCAGTCATTTAAGCTGAAGCTCAGCAGCTAGCTTCCTCACTCCAGTGACTCAAGGGCTGCTGCTCAC

GCATCTCCTCATACAAACCTGGCTCTGAAGGATAGAGCTCTGCCTCTCCAGTCTGCCCCGAGGCCCTACAGAGAAAGCAGAGAGGCTAATGGGAAAAGGA

GGGTCAGACCTAAGGGAACAAGAAATGGGGGTGAGAGAGCTGGATACTAATTGCTTAACATGTAGGGTATGCCATCAGAGACAAAGCAGCAGGTACAGTA

CTTAACCCTTGTGCTCTTCTATTGAGAAGCTAATGGGATATCTTGGGATAATGACCCGTGCTACTGCTGTCTTCACAGAACTCATGACAGGGAGATGCCA

GCTTGGGTTGCCTCCTCCAGAAGTGTGTAACTATGTAATCTATCTTTGTCTTAGTTATGTTTCTCAATGGAACATAAGAACCAGACGAGAACAATTTACA

AGAAGGAGAACTTATTTGGGCTCATGATCTAAAGCCCATCATGGAGGGCAGGTTAAGGCAGCCATGGCGAGAAGAGCATACAGCCAGGACCCCTCACTTC

ACATGTCAGAACAAGGAGAGGAGAGACAAGGAGTGTGGCTGAGCTGTAAACCCCAAGGCTTGACAGCTCCTCCCGTGAGGCTCCACCTCCTAAAGGATTC

ATAATTTCTCAAAACAGTGTCACCAGCTGAGAGCCAAGTGTTCAAAATGAGCCCGTGGGGGGGGGGGGGAGACTTTCCACATGCAAACAGACATCAAGTA

AAGCCTTCTCTGGTTTGAGGATTCGCTAAGATGGCTTGCTAGACTCAGGCCTTGCAGTCGTTCACAGCATTCCCTGCCCATTCTTGCTTCTCTTTGTACT

GATCATCCAGGGCAGCTCAAAACCCAGCTCCCTTAGATCCACTGTGCATCTCCCCAGCTGTTCTGTTCTAGGAATCATTATTCGGCACAGTGAGCATCTA

AGACGTGAAGGCGATGCACTGTCTCCCATTGATCTGTGTATAAGAACGGAATTCTTTTTTGCATAATTAATGAAGGATCATAGTTTTTCATTAGGATTCA

TGTTGGTCTCATGCTCTTTTAAATTCCTGTTAGTAAAATGAGATTAATAACGGTTTGGTCTCTGTGAGCAGCACTGAAGTAGAATAAGAAACCTTCATCT

ACTTGAAGTCTGCATCCGGGTCCTGCCTTGCCGCTCCCTGATACTCAAGCCATTCATACACACTACACTTCCTAAGGGCCCTCCATCGGAGTTTTGTATT

CTCCACAGTAGGAGGTAACTTTCTCAACAGCACATCAGTGTACCCAACAGCTGAGTATTGGGGCTACGGTCTTTACCTCAGCCCAGCATCCCAAAGCTTG

AGTCTGGCTTTATAAAGCTGTTGTTGGAGATGGATGTTTCCGTTTAGATTCTAGGATGGAATACTTAACATACGATTGTGGTTTTGAAGAAGAAAGAGAC

CTTGCCATTATAAGTAATCAAACAGCCTTCATCTCCTGAAAAAAAAAGGAGAGGAAAGAAGAAACTGAGACAAGAATCATTCTGGCTCACTGTTTGAGGG

TACAGGGAAGGGGACAGGAGAGACAAGGCCACAGGAGTGTGACAGAGGCAGCTGGTCACATTGTGTCTGCAGGCAGGAAGCAGAGAAAGTTGAATGCTGT

GCTCAGCCTACTGATTTTTATCTAGTCTGGGACCCCAGCCTATGAAACGGTACCACCACAGTTAGGGTGGGTCTTTCCCCCGAAGTTAATCATCACTGTT

TTTAGTAGTTGATACGTAAGTAACACAGAATTCAAAAAGCAAAAGGATGTCTGATTAAAAACCCTAATTATCTGCCTCCCCTCTTCCCCATCAGTCTCTA

CTCTCCATGGAGATGACTGTCTTGATCCATTTCTTCTGCATGATTCCAGAAATACTCTGTGCAAATAAAGCCTGAATGAACGAACATA
Translation
MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEV - UNI25474 - - UNI31655 - VSEFQEEGMNAINLPLSPISFELDPED

TLLE EENEVRTMVDPNSRNDPKLQELMK VLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFE EKLESEKLNVAEVTQSEIAQKQKLQTVLEKINET

LKLPPRSIKWNVDS SVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQ KREGILQSRQIQEEITGNTE EALSGRHE ERDAFDTLFDHAPDK

LNVVKK TLITFVNKHLNKLNLEVTELETQ FADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQK VLNVSFAFELMQDGGLEKPKPRPED DIVNCDLK

STLRVLYNLFTKYRNVE
Transcript ENSMUST00000106643
Sequence
AGTATAGGAACCCATCCATGCAGGAG CCGCAGCCTCAGTCCCGCCGCCGCCCGCCGCGGCCGCCCAGCTCCAGCTCCGCGTCCAGCCGCCATGGCCACA

TCCCCACAGAAGTCGCCCTTGGTCCCCAAATCACCCACTCCCAAGTCGCCTCCGTCCCGCAAGAAGGATGACTCGTTCTTGGGGAAACTCGGAGGGACGC

TGGCCCGGAGGAAGAAAGCCAAAGAAG - UNI25474 - - UNI31655 - TATCCGAGTTCCAGGAGGAAGGAATGAACGCCATCAACCTGCCTCT

TAGCCCCATCTCCTTCGAGCTGGACCCCGAGGACACTCTGCTGG AGGAGAATGAGGTCCGGACAATGGTCGATCCAAACTCACGCAATGACCCCAAACT

TCAAGAGCTGATGAAG GTGCTCATCGACTGGATCAATGACGTATTGGTGGGAGAAAGAATCATCGTGAAGGACCTCGCTGAAGATCTCTATGATGGCCA

AGTCCTACAGAAGCTCTTCG AGAAACTGGAGAGTGAGAAGCTCAACGTGGCCGAGGTTACGCAGTCGGAGATCGCCCAGAAACAGAAGCTACAGACTGT

GCTGGAGAAGATCAATGAGACCCTGAAGCTTCCTCCCAGGAGCATCAAGTGGAACGTGGACT CTGTTCATGCCAAGAACCTGGTTGCCATCCTCCACCT

GCTGGTTGCTCTGTCTCAATATTTCCGGGCACCCATCCGACTCCCAGACCATGTTTCCATCCAAGTGGTTGTGGTCCAG AAACGAGAAGGGATCCTCCA

GTCTCGACAAATCCAAGAGGAAATAACTGGTAACACAGA GGCCCTTTCCGGAAGGCATG AACGTGATGCCTTTGACACGCTGTTTGACCATGCACCAG

ACAAACTCAATGTGGTGAAGAAG ACCCTCATCACGTTCGTGAACAAGCATCTGAATAAACTGAACTTGGAGGTCACAGAACTGGAGACACAG TTTGCA

GATGGGGTTTACCTGGTGTTGCTCATGGGGCTCCTGGAAGGCTACTTTGTACCCCTGCACAGCTTCTTCCTGACCCCAGACAGCTTTGAACAGAAG GTC

CTGAATGTCTCCTTTGCCTTTGAGCTCATGCAAGATGGAGGGCTGGAAAAGCCTAAACCGCGGCCAGAAG ACATTGTCAACTGTGACCTGAAGTCCACG

CTGAGAGTGCTATACAACCTCTTCACCAAGTACCGGAATGTGGAGTGAGACCCTGGGCTGCCTCCTGCTGCCCAGCCACTCTTCGTGAAGGCCATCTGGA

CCAGCTTCCCAACAGCCTTGCCCTGCTTGCTCCTGTCTCTTGTTCCACCCTCTCCCACAAGCCCAGCAACCACCCAGAGATAGTGGACATTAAAATCAGT

AAGGAAGTGACCACTAACCCAGTGAACTAATAACATCTGTAGGCTCTGGGGACTGAACCAGCAATGTCTTGGGAAATTGTCTCCATCCAAATTCAGGCCC

TAGAGGTTCCTACATGTGCTGTGGGGATCAACACAGCCCAGAGACAGTCCCCCTGAACATAGGAATAAAGATCAGAATTAGTCCCCACAATAAGGGGGAG

TCTCTACCGTGCTCAAGTTCATTAGGTTTATGTCTTATTAAAGGAGATCATTCCTCCCTGTTGTAGATGAAGAAACTGAGGCCCAGAGATGCGAAGGTTT

GCTATCCATTAGCATGTATTCTCTGGGTGACTTACTGGTTTATGACTGGTCAACTGCATTCCATTCTGTGTGTGTCCTAAAATGTGTGCATGCTTGTTCA

GACCAGCCTTACCTGCATATACCTGTGTCCTCTAGCAGACAAGACACTCTGATCTCACCCTAGGGCAGGCCAGGTCAGGGCTGGGTGATTCTCACTAAAA

TTGCCAAATTGAATTTAACTCTATTAATACTGTGTGTGGCAGGAGCCTCATCCCTCAAATCCTTTGTACAAATGAAAATTACCCTTAATTCCTTCAGATT

GGTAATAAGCCCACGCTCCGGTTGCAAGATGACATTTGGGAAGCGTTCTGTTTGGAATTAATAGAGTGCCCATTTCGCAGCCTTTTTGCTTGATTGCATG

TAATGGATGTGCCCTATATTTTCCTGCAAAATAAGTACTCAATTCATTATCGTTAGGCAAATGTAGGGTATGCTTGCACATGGCAAAGAGCTGGGTGCAG

ACCCACTGGAGCATCGCCTGAGAAGTAGGGCTCGTCAACAGAGACCCTTGAACTTTGAGGG
Translation
 MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEV - UNI25474 - - UNI31655 - VSEFQEEGMNAINLPLSPISFELDPE

DTLLE EENEVRTMVDPNSRNDPKLQELMK VLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFE EKLESEKLNVAEVTQSEIAQKQKLQTVLEKINE

TLKLPPRSIKWNVDS SVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQ KREGILQSRQIQEEITGNTE EALSGRHE ERDAFDTLFDHAPD

KLNVVKK TLITFVNKHLNKLNLEVTELETQ FADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQK VLNVSFAFELMQDGGLEKPKPRPED DIVNCDL

KSTLRVLYNLFTKYRNVE
Transcript ENSMUST00000106640
Sequence
ACACACCTCAGAAGGCTGTCCTGAGAGCAGACACAGGGGACCCCACAGAGAGCGGGCAGCCGCACAGAAGAGACGATGATTGTGGCTGCAGTATTAGACC

ATGGGCTGCGGGGCACTTTGCCCTAAAG - UNI25474 - TATCCGAGTTCCAGGAGGAAGGAATGAACGCCATCAACCTGCCTCTTAGCCCCATCTC

CTTCGAGCTGGACCCCGAGGACACTCTGCTGG AGGAGAATGAGGTCCGGACAATGGTCGATCCAAACTCACGCAATGACCCCAAACTTCAAGAGCTGAT

GAAG GTGCTCATCGACTGGATCAATGACGTATTGGTGGGAGAAAGAATCATCGTGAAGGACCTCGCTGAAGATCTCTATGATGGCCAAGTCCTACAGAA

GCTCTTCG AGAAACTGGAGAGTGAGAAGCTCAACGTGGCCGAGGTTACGCAGTCGGAGATCGCCCAGAAACAGAAGCTACAGACTGTGCTGGAGAAGAT

CAATGAGACCCTGAAGCTTCCTCCCAGGAGCATCAAGTGGAACGTGGACT CTGTTCATGCCAAGAACCTGGTTGCCATCCTCCACCTGCTGGTTGCTCT

GTCTCAATATTTCCGGGCACCCATCCGACTCCCAGACCATGTTTCCATCCAAGTGGTTGTGGTCCAG AAACGAGAAGGGATCCTCCAGTCTCGACAAAT

CCAAGAGGAAATAACTGGTAACACAGA GGCCCTTTCCGGAAGGCATG AACGTGATGCCTTTGACACGCTGTTTGACCATGCACCAGACAAACTCAATG

TGGTGAAGAAG ACCCTCATCACGTTCGTGAACAAGCATCTGAATAAACTGAACTTGGAGGTCACAGAACTGGAGACACAG TTTGCAGATGGGGTTTAC

CTGGTGTTGCTCATGGGGCTCCTGGAAGGCTACTTTGTACCCCTGCACAGCTTCTTCCTGACCCCAGACAGCTTTGAACAGAAG GTCCTGAATGTCTCC

TTTGCCTTTGAGCTCATGCAAGATGGAGGGCTGGAAAAGCCTAAACCGCGGCCAGAAG ACATTGTCAACTGTGACCTGAAGTCCACGCTGAGAGTGCTA

TACAACCTCTTCACCAAGTACCGGAATGTGGAGTGAGACCCTGGGCTGCCTCCTGCTGCCCAGCCACTCTTCGTGAAGGCCATCTGGACCAGCTTCCCAA

CAGCCTTGCCCTGCTTGCTCCTGTCTCTTGTTCCACCCTCTCCCACAAGCCCAGCAACCACCCAGAGATAGTGGACATTAAAATCAGTAAGGAAGTGACC

ACTAACCCAGTGAACTAATAACATCTGTAGGCTCTGGGGACTGAACCAGCAATGTCTTGGGAAATTGTCTCCATCCAAATTCAGGCCCTAGAGGTTCCTA

CATGTGCTGTGGGGATCAACACAGCCCAGAGACAGTCCCCCTGAACATAGGAATAAAGATCAGAATTAGTCCCCACAATAAGGGGGAGTC
Translation
MGCGALCPKV - UNI25474 - VSEFQEEGMNAINLPLSPISFELDPEDTLLE EENEVRTMVDPNSRNDPKLQELMK VLIDWINDVLVGERIIVKD

LAEDLYDGQVLQKLFE EKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDS SVHAKNLVAILHLLVALSQYFRAPIRLPDHVSIQ

VVVVQ KREGILQSRQIQEEITGNTE EALSGRHE ERDAFDTLFDHAPDKLNVVKK TLITFVNKHLNKLNLEVTELETQ FADGVYLVLLMGLLEGYF

VPLHSFFLTPDSFEQK VLNVSFAFELMQDGGLEKPKPRPED DIVNCDLKSTLRVLYNLFTKYRNVE

For any suggestions or comments, please send an email to unitrap@crg.es