Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030795 (Fus)
Chromosomal location
Chr 7: 135111004 - 135125546 (+)
Description
fusion, derived from t(12;16) malignant liposarcoma (human) Gene [Source:MGI (curated);Acc:Fus-007]
RefSeq_dna
NM_139149 
RefSeq_peptide
NP_631888.1 
UniGene
Mm.407870 
MGI
MGI:1353633 
Uniprot/SWISSPROT
P56959 
Uniprot/SPTREMBL
Q91VQ2 Q3UK30 Q3USY4 Q564D0 Q8CFQ9 
Human Ortholog
ENSG00000089280 (FUS)
Omim not available
UniTrap UNI5483
Vector Insertion
Chr 7: 135111014 - 135111092
Public Clones YTA011 (baygenomics) M052A07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38426
Vector Insertion
Chr 7: 135111092 - 135113075
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4853
Vector Insertion
Chr 7: 135117949 - 135119401
Public Clones AH0051 (sanger) PST14771-NR (escells) PST14771-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15735
Vector Insertion
Chr 7: 135119435 - 135120731
Public Clones PST403-3 (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37429
Vector Insertion
Chr 7: 135120836 - 135121654
Public Clones PST21851-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15147
Vector Insertion
Chr 7: 135121785 - 135123405
Public Clones PST8927-NR (escells) PST8059-NR (escells) PST12232-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15266
Vector Insertion
Chr 7: 135123508 - 135123636
Public Clones PST10372-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6778
Vector Insertion
Chr 7: 135123708 - 135123761
Public Clones YHA365 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37475
Vector Insertion
Chr 7: 135123761 - 135124704
Public Clones PST19615-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106249
Sequence
GCATCGCTTCGCGGTCGTCTGGAACTTTGTTGCTTGGCGGCCTGCGCTGCGCGCGTGCGCGGACATGGCTTCAAACG - UNI5483 - ACTATACCCA

ACAAGCAACTCAAAG CTACGGGGCCTATCCTACCCAGCCTGGGCAGGGCTACTCCCAACAGAGCAGTCAGCCCTATGGCCAACAGAGTTACAGTGGTTA

TGGCCAGTCAGCTGACACTTCAGGATACGGCCAGAGCAGCTATGGTTCTTCTTATGGACAGACCCAAAACA CAGGCTATGGAACTCAGTCAGCTCCCCA

GGGATATGGTTCCACTGGAGGCTATGGCAGCAGCCAAAGTTCACAATCTTCTTATGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAACAGCCAGCTCCT

AGCAGCACCTCAGGAAG TTATGGTGGCAGTTCTCAGAGCAGCAGCTATGGGCAACCCCAGAGTGGAGGTTATGGTCAACAGTCTGGCTATGGTGGACAG

CAACAAAGCTACGGACAACAACAAAGCTCCTATAACCCACCTCAGGGTTATGGACAACAGAACCAGTACAACAGTAGCAGTGGAG - UNI4853 - - 

UNI6778 - - UNI15147 - - UNI15266 - - UNI15735 - - UNI37429 - GTGGTGGAGGTGGAGGACAGCAACGAGCTGGAGACTGG

AAGTGTCCTAATCC - UNI6778 - - UNI37475 - TACATGTGAGAACATGAACTTCTCTTGGAGAAATGAATGCAACCAGTGTAAGGCACCTAA

GCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATGG GGGGAAACTATGGAGATGATCGACGTGGCAGAGGAGGATATGACCGGGGCGGCTACCG

GGGCCGAGGAGGGGACCGTGGGGGCTTCAGAGGGGGCCGGGGTGGTGGGGACAGAGGCGGTTTTGGCCCTGGCAAGATGGACTCCAG GGGCGAGCACAG

ACAGGATCGCAGGGAGAGGCCATATTAGCCTGGCTCCTGAAGTTCTGGAACTCTTCCTGTACCCAGTGTTACCCTTGTTATTTTGTAAACTTACAATTCA

GGATCGCTCATGGATATTTTTTTTTGGGGGGGGTGGGGCGGTTGTGTGTGTATGTGTGTGTGTGTGTGTCAGACTACCCTAATTGTAACCATATCTCTGG

TTCCCATTAAAAAACATCATTTTAGTTAAA
Translation
MASND - UNI5483 - DYTQQATQS SYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNT TGYGTQSAPQGYGSTGGY

GSSQSSQSSYGQQSSYPGYGQQPAPSSTSGS SYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGG - UNI4853 

- - UNI6778 - - UNI15147 - - UNI15266 - - UNI15735 - - UNI37429 - GGGGGGQQRAGDWKCPNP - UNI6778 - - U

NI37475 - PTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMG GGNYGDDRRGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSR RGEH

RQDRRERPY
Transcript ENSMUST00000106251
Sequence
GCATCGCTTCGCGGTCGTCTGGAACTTTGTTGCTTGGCGGCCTGCGCTGCGCGCGTGCGCGGACATGGCTTCAAACG - UNI5483 - ACTATACCCA

ACAAGCAACTCAAAG CTACGGGGCCTATCCTACCCAGCCTGGGCAGGGCTACTCCCAACAGAGCAGTCAGCCCTATGGCCAACAGAGTTACAGTGGTTA

TGGCCAGTCAGCTGACACTTCAGGATACGGCCAGAGCAGCTATGGTTCTTCTTATGGACAGACCCAAAACA CAGGCTATGGAACTCAGTCAGCTCCCCA

GGGATATGGTTCCACTGGAGGCTATGGCAGCAGCCAAAGTTCACAATCTTCTTATGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAACAGCCAGCTCCT

AGCAGCACCTCAGGAAG TTATGGTGGCAGTTCTCAGAGCAGCAGCTATGGGCAACCCCAGAGTGGAGGTTATGGTCAACAGTCTGGCTATGGTGGACAG

CAACAAAGCTACGGACAACAACAAAGCTCCTATAACCCACCTCAGGGTTATGGACAACAGAACCAGTACAACAGTAGCAGTGGAGGTGGTGGAGGGGGTG

GTGGAG GCAACTATGGCCAAGATCAGTCCTCTATGAGTGGTGGCGGTGGCGGTGGTGGTTATGGCAATCAGGACCAGAGTGGTGGCGGCGGCGGCGGCT

ACGGGGGAGGCCAACAGGATCGTGGGGGCCGAGGCAGGGGCGGTGGAGGTGGTTACAACCGAAGCAGTGGTGGCTATGAACCCAGAGGCCGTGGAGGTGG

CCGAGGAGGCAGAGGCGGCATGGG CGGAAGTGACCGCGGTGGCTTCAATAAATTTGGTG - UNI4853 - GTCCTCGGGATCAAGGATCTCGTCATG

ATTCTG - UNI15735 - AACAGGATAATTCAGACAACAATACCATCTTCGTGCAAGGCCTAGGCGAGAATGTTACAATTGAATCTGTGGCTGATTAC

TTCAAGCAGATTGGAATTATTAAG - UNI37429 - ACAAACAAGAAAACTGGACAGCCTATGATTAATTTGTACACAGACAGGGAAACTGGCAAGTT

GAAGGGTGAGGCAACAGTTTCATTTGATGACCCACCTTCTGCTAAAGCAGCTATCGACTGGTTTGATG - UNI15147 - GTAAAGAATTCTCTGGGA

ATCCTATTAAAGTTTCATTTGCTACCCGCCGAGCTGACTTCAATCGGGGTGGTGGAAATGGTCGCGGAGGCCGAGGGCGAGGAG - UNI15266 - GA

CCCATGGGCCGTGGAGGCTATGGAGGAGGTGGCAGTGGTGGTGGTGGCCGGGGAGGATTCCCCAGTGGAGGTGGTGGAGGTGGAGGACAGCAACGAGCTG

GAGACTGGAAGTGTCCTAATCC - UNI6778 - - UNI37475 - TACATGTGAGAACATGAACTTCTCTTGGAGAAATGAATGCAACCAGTGTAAG

GCACCTAAGCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATGG GGGGAAACTATGGAGATGATCGACGTGGCAGAGGAGGATATGACCGGGGC

GGCTACCGGGGCCGAGGAGGGGACCGTGGGGGCTTCAGAGGGGGCCGGGGTGGTGGGGACAGAGGCGGTTTTGGCCCTGGCAAGATGGACTCCAG GGGC

GAGCACAGACAGGATCGCAGGGAGAGGCCATATTAGCCTGGCTCCTGAAGTTCTGGAACTCTTCCTGTACCCAGTGTTACCCTTGTTATTTTGTAAACTT

ACAATTCAGGATCGCTCATGGATATTTTTTTTTGGGGGGGGTGGGGCGGTTGTGTGTGTATGTGTGTGTGTGTGTGTCAGACTACCCTAATTGTAACCAT

ATCTCTGGTTCCCATTAAAAAACATCATTTTAGTT
Translation
MASND - UNI5483 - DYTQQATQS SYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNT TGYGTQSAPQGYGSTGGY

GSSQSSQSSYGQQSSYPGYGQQPAPSSTSGS SYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGG GNY

GQDQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGGRGGRGGMG GGSDRGGFNKFGG - UNI4853 - GPR

DQGSRHDSE - UNI15735 - EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIK - UNI37429 - TNKKTGQPMINLYTDRETGKLKGEATVS

FDDPPSAKAAIDWFDG - UNI15147 - GKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGG - UNI15266 - GPMGRGGYGGGGSGGGGRGGF

PSGGGGGGGQQRAGDWKCPNP - UNI6778 - - UNI37475 - PTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMG GGNYGDDRRGRGGYDRG

GYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSR RGEHRQDRRERPY
Transcript ENSMUST00000077609
Sequence
CAGTCCTCGCGGCATCGCTTCGCGGTCGTCTGGAACTTTGTTGCTTGGCGGCCTGCGCTGCGCGCGTGCGCGGACATGGCTTCAAACG - UNI5483 -

 ACTATACCCAACAAGCAACTCAAAG CTACGGGGCCTATCCTACCCAGCCTGGGCAGGGCTACTCCCAACAGAGCAGTCAGCCCTATGGCCAACAGAGT

TACAGTGGTTATGGCCAGTCAGCTGACACTTCAGGATACGGCCAGAGCAGCTATGGTTCTTCTTATGGACAGACCCAAAACA GCTATGGAACTCAGTCA

GCTCCCCAGGGATATGGTTCCACTGGAGGCTATGGCAGCAGCCAAAGTTCACAATCTTCTTATGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAACAGC

CAGCTCCTAGCAGCACCTCAGGAAG TTATGGTGGCAGTTCTCAGAGCAGCAGCTATGGGCAACCCCAGAGTGGAGGTTATGGTCAACAGTCTGGCTATG

GTGGACAGCAACAAAGCTACGGACAACAACAAAGCTCCTATAACCCACCTCAGGGTTATGGACAACAGAACCAGTACAACAGTAGCAGTGGAGGTGGTGG

AGGGGGTGGTGGAG GCAACTATGGCCAAGATCAGTCCTCTATGAGTGGTGGCGGTGGCGGTGGTGGTTATGGCAATCAGGACCAGAGTGGTGGCGGCGG

CGGCGGCTACGGGGGAGGCCAACAGGATCGTGGGGGCCGAGGCAGGGGCGGTGGAGGTGGTTACAACCGAAGCAGTGGTGGCTATGAACCCAGAGGCCGT

GGAGGTGGCCGAGGAGGCAGAGGCGGCATGGG CGGAAGTGACCGCGGTGGCTTCAATAAATTTGGTG - UNI4853 - GTCCTCGGGATCAAGGATC

TCGTCATGATTCTG - UNI15735 - AACAGGATAATTCAGACAACAATACCATCTTCGTGCAAGGCCTAGGCGAGAATGTTACAATTGAATCTGTGG

CTGATTACTTCAAGCAGATTGGAATTATTAAG - UNI37429 - ACAAACAAGAAAACTGGACAGCCTATGATTAATTTGTACACAGACAGGGAAACT

GGCAAGTTGAAGGGTGAGGCAACAGTTTCATTTGATGACCCACCTTCTGCTAAAGCAGCTATCGACTGGTTTGATG - UNI15147 - GTAAAGAATT

CTCTGGGAATCCTATTAAAGTTTCATTTGCTACCCGCCGAGCTGACTTCAATCGGGGTGGTGGAAATGGTCGCGGAGGCCGAGGGCGAGGAG - UNI15

266 - GACCCATGGGCCGTGGAGGCTATGGAGGAGGTGGCAGTGGTGGTGGTGGCCGGGGAGGATTCCCCAGTGGAGGTGGTGGAGGTGGAGGACAGCA

ACGAGCTGGAGACTGGAAGTGTCCTAATCC - UNI6778 - - UNI37475 - TACATGTGAGAACATGAACTTCTCTTGGAGAAATGAATGCAACC

AGTGTAAGGCACCTAAGCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATGG GGGGAAACTATGGAGATGATCGACGTGGCAGAGGAGGATATG

ACCGGGGCGGCTACCGGGGCCGAGGAGGGGACCGTGGGGGCTTCAGAGGGGGCCGGGGTGGTGGGGACAGAGGCGGTTTTGGCCCTGGCAAGATGGACTC

CAG GGGCGAGCACAGACAGGATCGCAGGGAGAGGCCATATTAGCCTGGCTCCTGAAGTTCTGGAACTCTTCCTGTACCCAGTGTTACCCTTGTTATTTT

GTAAACTTACAATTCAGGATCGCTCATGGATATTTTTTTTTGGGGGGGGTGGGGCGGTTGTGTGTGTATGTGTGTGTGTGTGTGTCAGACTACCCTAATT

GTAACCATATCTCTGGTTCCCATTAAAAAACATCATTTTAGTTAAA
Translation
MASND - UNI5483 - DYTQQATQS SYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNS SYGTQSAPQGYGSTGGYG

SSQSSQSSYGQQSSYPGYGQQPAPSSTSGS SYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGG GNYG

QDQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGGRGGRGGMG GGSDRGGFNKFGG - UNI4853 - GPRD

QGSRHDSE - UNI15735 - EQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIK - UNI37429 - TNKKTGQPMINLYTDRETGKLKGEATVSF

DDPPSAKAAIDWFDG - UNI15147 - GKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGG - UNI15266 - GPMGRGGYGGGGSGGGGRGGFP

SGGGGGGGQQRAGDWKCPNP - UNI6778 - - UNI37475 - PTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMG GGNYGDDRRGRGGYDRGG

YRGRGGDRGGFRGGRGGGDRGGFGPGKMDSR RGEHRQDRRERPY
Transcript ENSMUST00000121616
Sequence
GCATCGCTTCGCGGTCGTCTGGAACTTTGTTGCTTGGCGGCCTGCGCTGCGCGCGTGCGCGGACATGGCTTCAAACG - UNI5483 - ACTATACCCA

ACAAGCAACTCAAAG CTACGGGGCCTATCCTACCCAGCCTGGGCAGGGCTACTCCCAACAGAGCAGTCAGCCCTATGGCCAACAGAGTTACAGTGGTTA

TGGCCAGTCAGCTGACACTTCAGGATACGGCCAGAGCAGCTATGGTTCTTCTTATGGACAGACCCAAAACA CAGGCTATGGAACTCAGTCAGCTCCCCA

GGGATATGGTTCCACTGGAGGCTATGGCAGCAGCCAAAGTTCACAATCTTCTTATGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAACAGCCAGCTCCT

AGCAGCACCTCAGGAAG TTATGGTGGCAGTTCTCAGAGCAGCAGCTATGGGCAACCCCAGAGTGGAGGTTATGGTCAACAGTCTGGCTATGGTGGACAG

CAACAAAGCTACGGACAACAACAAAGCTCCTATAACCCACCTCAGGGTTATGGACAACAGAACCAGTACAACAGTAGCAGTGGAGGTGGTGGAGGGGGTG

GTGGAG - UNI4853 - - UNI6778 - - UNI15147 - - UNI15266 - - UNI15735 - - UNI37429 - GTGGTGGAGGTGGAGGA

CAGCAACGAGCTGGAGACTGGAAGTGTCCTAATCC - UNI6778 - - UNI37475 - TACATGTGAGAACATGAACTTCTCTTGGAGAAATGAATG

CAACCAGTGTAAGGCACCTAAGCCAGATGGCCCAGGAGGGGGACCAGGAGGCTCTCATATGG GGGGAAACTATGGAGATGATCGACGTGGCAGAGGAGG

ATATGACCGGGGCGGCTACCGGGGCCGAGGAGGGGACCGTGGGGGCTTCAGAGGGGGCCGGGGTGGTGGGGACAGAGGCGGTTTTGGCCCTGGCAAGATG

GACTCCAG GGGCGAGCACAGACAGGATCGCAGGGAGAGGCCATATTAGCCTGGCTCCTGAAGTTCTGGAACTCTTCCTGTACCCAGTGTTACCCTTGTT

ATTTTGTAAACTTACAATTCAGGATCGCTCATGGATATTTTTTTTTGGGGGGGGTGGGGCGGTTGTGTGTGTATGTGTGTGTGTGTGTGTCAGACTACCC

TAATTGTAACCATATCTCTGGTTCCCATTAAAAAACATCATTTTAGTTAAA
Translation
MASND - UNI5483 - DYTQQATQS SYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNT TGYGTQSAPQGYGSTGGY

GSSQSSQSSYGQQSSYPGYGQQPAPSSTSGS SYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGG - U

NI4853 - - UNI6778 - - UNI15147 - - UNI15266 - - UNI15735 - - UNI37429 - GGGGGGQQRAGDWKCPNP - UNI677

8 - - UNI37475 - PTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMG GGNYGDDRRGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMD

SR RGEHRQDRRERPY

For any suggestions or comments, please send an email to unitrap@crg.es