Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030850 (Ate1)
Chromosomal location
Chr 7: 137535040 - 137663475 (-)
Description
arginyltransferase 1 Gene [Source:MGI Symbol;Acc:MGI:1333870]
RefSeq_dna
NM_001029895 NM_013799 
RefSeq_peptide
NP_001025066.1 NP_038827.2 NP_001129526.1 
UniGene
Mm.397324 Mm.400833 Mm.216321 
MGI
MGI:1333870 
Uniprot/SWISSPROT
Q9Z2A5 
Uniprot/SPTREMBL
Q3UUL7 Q4FCQ7 Q8BP95 Q8CFP7 Q4FCQ6 Q80YP1 
Human Ortholog
ENSG00000107669 (ATE1)
Omim not available
UniTrap UNI33293
Vector Insertion
Chr 7: 137662869 - 137663476
Public Clones IST14579E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27379
Vector Insertion
Chr 7: 137652773 - 137654324
Public Clones IST12819C2 (tigm)
Private Clones OST61199 (lexicon) OST59700 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21799
Vector Insertion
Chr 7: 137625230 - 137647235
Public Clones not available
Private Clones OST317494 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4228
Vector Insertion
Chr 7: 137562083 - 137607644
Public Clones AD0874 (sanger) AC0060 (sanger) AL0039 (sanger)
Private Clones OST409341 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5085
Vector Insertion
Chr 7: 137538251 - 137561961
Public Clones YTC618 (baygenomics)
Private Clones OST451439 (lexicon) OST36077 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094017
Sequence
ATGGCCTCGGTGGTGGAATACAAGGGCCTGAAGGCCGGCTACTACTGCGGCTACTGCGAGTCCAGGGAGGGCAAGACGTCGTGTG - UNI33293 - G

CATGTGGGCACATTCCATGACAGTGCAGGATTATCAGGATCTTATAGACCGAGGATGGAGAAG AAGTGGGAAATATGTGTACAAACCTGTCATGGATCA

AACATGCTGTCCTCAGTATACAATAAG GTGTCATCCTTTACAGTTTCAGCCATCAAAATCTCACAAGAAAGTTTTGAAAAAAATGCTGAAATTTCTGGC

TAAAGGAGAGATCTCGAAAGGCAATTGTGAGG - UNI27379 - ATGAGCCCATGGATTCTACAGTGGAGGATGCTGTTGACGGTGACTTTGCATTAA

TTAACAAGCTGGATATAAAGTGTGATCTCAAAACACTCAGTGACCTCAAAGGAAGCATAGAGAGTGAAGAGAAGGAGAAAGAAAAGAGTATAAAGAAAGA

AGGGTCTAAAGAATTCATTCATCCACAATCTATAGAGGAGAAGTTGGGCTCTGGTGAACCATCACATCCAATCAAAGTTCATATTGGTCCTAAGCCAG G

CAAAGGGGCTGACTTGAGTAAGCCTCCATGTCGGAAAGCAAGGGAAATGAGGAAAGAAAGGCAAAGATTAAAACGGATGCAGCAGGCCTCAGCTGCAGCC

TCGGAGGCTCAAGGTCAGCCAGTCTGTTTGTTACCAAAGGCTAAATCCAACCAGCCCAAGTCACTGGAAGATTTGATTTTTCAATCTTTACCAGAAAATG

CATCGCACAAGTTAGAG GTGAGGGTGGTAAGATCTTCTCCACCAAGTCCTCAGTTCAGAGCCACATTTCAGGAGTCTTACCAGGTCTATAAACGCTACC

AGATGGTTGTTCACAAGGACCCGCCTGATAAGCCAACCGTGAGCCAG - UNI21799 - TTTACAAGATTCCTTTGCAGCTCACCATTGGAG GCAGA

GCACCCTGCTGATGGACCAGAATGTGGTTATGGCTCCTTTCACCAGCAGTACTGGCTCGATGGGAAGATCATTGCTGTGGGGGTGTTAGACATTCTCCCG

TACTGTGTGTCTTCTGTGTATCTCTACTACGATCCTGATTATTCATTTCTGTCTTTGGGTGTCTATTCAGCATTAAG AGAAATTGCTTTTACTAGACAA

CTGCATGAGAAAACATCGCAACTCAGCTATTATTATATGGGTTTCTACATTCATTCCTGTCCCAAGATGAGATACAAG - UNI4228 - GGTCAATAT

AGACCTTCTGATTTGCTGTGTCCTGAGACGTATGTCTGGGTGCCCATTGAGCAGTGCCTGCCTTCTCTGGACAACTCCAAGTACTGCCGTTTCAACCAGG

ACCCCGAAGCAG - UNI5085 - AGGATGAAGGACGCAGTAAGGAACTTGACCGACTAAGGGTGTTTCACAGACGATCTGCCATGCCTTACGGTGTTT

ATAAGAATCACCAAGAAGACCCAAGTGAGGAGGCTGGTGTGCTGGAGTATGCAAACCTCGTAGGACAGAAGTGCTCGGAGAGGATGCTGCTGTTCAGACA

CTGAAGGCCTGCACCTCAGCCCAGCGCCAGCCTGGCATCTCTTGCCACAGTCCCACCTGCTTCTCGGCTCCTGCAGCCATTCACCAAGTACATTCGTAGA

GCTTTTTAAAAATATTTTGTGGAATTGTATTTATGAGAATCTTGTGGTTAATATAAAGATTTTAAAATATTCTATGACCTAGCCCTTTAATTGGGACTTG

TCCTTTGCAGCTTGCTTCTGGAGCAAGGTGTGCTTCATGTCTCCAGTGAATATTTAGGGAAGGAAAATGAAGAAGTCAATATAAGTCATTTTGTCACAGT

TACTGTTCTGTGCTGGAGAAATTCTGACACAGAGACTGTTCTTTTAGACCAATGGTTCTTAACCTGTGGGCTCACCACACTCACAGGCCGAATGTTAGAT

AGCCTGTGTGAGATCAACTCATAATAACTCATAATCGTAGCAAAATTACAGTTATGAAGTAGCAACAAAATAATTTTATGGTTTGGGGTGGGATCACCAC

AACGTGAGGAAATGTATTAAAGGATGGCAGTATTAGGAAGGTAGAGAAAGAACCACTGGCTAAGACCCATGCAAGACATTAGCTTATGCTGGGAAATTCA

GATGGGCTTAAAGGTGAAGAGCACATTCCATCCCAGGAAATGTGCCTTTCCCACAAACCAGAACCCTGTTACTCTGCTTGATAGTAAACCTGCCAGTGTT

GTAGTGTATAATAGACAACAGGAACTGTAAACATTGCAAACATCAGGTGTTCACTTTGGGTGTCTGTCCAGGACTGTCCTGCCTATGTCTGTTGTCTTGG

CATAATTGTTTTCCTTGTCACTAGTGTTCCCTTGTGCCCCAGAGTTATCTCTGTTTGGATGATAAAATATGCAGTGATCTTAGTGGTGTTTGTTCTATTT

CTACAAATATAAGAAACAACTTTCTAAAGAAACGTCGTAACTCCTGCTTGATCTGAGGCTTATCCAAAGAAAATAGCTTCCTACTTTCCATTCTCTGGAA

CTCAGACGCTTTTTTGTGGTTAGTGATAGAAGTGATTATTATCTAGTCCCGTAGCTATGCACAGCCGTAGTGGAGTTGGTGGGGCCTCTAGCCTCTGCAT

TCCTCTTCTAGTTGTGGGTCAGAGAGTAGGCGCTGCCATGGTACTTCAGAATGGAGACCAGCCATTCACTTTCATTCTTGTGCTGTTGGGCCTTCTGCTT

GTTCACCAAATGCCTGCTGTCAAGGAGGCAGGCAGCCAGCTACTTCGTGAGGCACATCAGACCTGGTGAGGAGAGGCTTCCCTCAGGTGCTCGGGAAGCT

GGATGCACAGGTTAGCCCTTTGTTTGAACTTGTTCTCAGCTAGCCCCTTCTAGAAGTGCTTCCAAGCCTGGCCTTGGAGCTGCTGAGAGCACCTATCCCA

CAGTGAGGGTAGGGTTGTTACTTTATTTCTTTTCATAAAAATCACTCCAATGGGAAGCACCTGGAACGCTAAGAAATTAAAAGTCGTTTGAAATCCTCCC

AGGCATAGAGAAAGGAGCATTATGGAAACCCACAAATCTCTTGTCCACCCCAAATAAAACTGTGCATTCCTTGCTATGTAGTTGCCCTCGGTGAATGTGT

GTGAGATTGAAGATTGCAGAAGATGTGATAGGTAATCTCAGTATTCTTCAGTAGGATGGGATCACATATATGACCTTGGCATTGGGCAGCCAGGCATATC

CTGGTAGGTGGTATAGCCATGCTACCAGAGGGGTTTGTTTTTGGGAGGGGGCGGGGGGTCAGCCCAACATCTTACCCTAGCTCTGAGTTTCTCCTGCAGA

GAATAGAGGAAAATGGCTCACTGTCCCTGTTTCTAGACTGATGCGCCTAACCTAGGGTGGCCCTACTGAGGCTTCAGAGCGTCTTGGGCATGAAAACTCT

CTCTTCAGCTCAGTTGCTTTGTATTCATTCTTTCCTCCCTCCTCCCTCTATCCTCTCCTCAATACAGTTTTTTTCGACTAGTATGAAACCTTAGGGTTCT

AGATGTTGTCGAAGATGTGTCCTTGGGTGGGACTGAGGAGATAGCCCAGTTAGTACAGTGCCTGAGTTCAGTTCTCTAGAGCCCATGTAAAATGTTGGGT

CTGGTAGTGTGTGTTTGAAATGCAGGCACTGGGGATTCAGTAGAGGAGTACCTCTTGGGCCCACTGGCCACTGGCCTAGCCACTGGGCATCGAGCCACTG

AGAGACCCTGTCTAAATGGAGTTGGACAGCATTTATGAGAACATTAGGGGCTTGCTAATATTTTGAGCTCTTGAGTGAGTGTCCATCACAGCTCGGTTAG

GACAGTCAAGAAAGTATCCCAACTTGGCATTTTTGTAAAGTCTCGCTGAGGCGGCTGATTCTGTCAGTGATTTTCATGTAAATAAAGATGCGTGCAAGCC

TTTCAGGGACAGTGTCTGACTTCTCCAGGTAGGAAGGTCTGTGTGTTCCATCTCCTTCTTAGTGTCCCCTTCTGAGTTCAGGTAGAGTCACACCTTCCTC

CATGCCTACAGCGTAGGGCTCATTTTGATTCTCAGTGTACCATCTTTATTTAAATTATTTTCAGTTCTCTGAGACTTTTGTTACTTTTATTACAGGTAAT

CTGAGCACTTTTATATTCTAAGATAGAAACTATATTATCAGATGAATATAGTCACTCAATTAAAATTATTTAGATAAAATTATTGTTTATGTTTTCTTTC

AAGCAATCTATCCTATTTTTATCCATTTGCAAATGCCAGTTTTGTGTGGTTTCTTAGCATATCAAAATTATTATGTAGAAGAATGTTTCTAGCTTTCTGA

ACAGCAAATAGTTTGGTGTGTAAATATTGTATTATTTCAGTGTGAATAAAGGTGAGAGAGAATATGAACATTTAACCAAAGTGATTCTACTGTGGCTGAC

TTAAAAGAACGGAAGGAAGTGAGTGGGGATTTGACACGTTTGAATTACGAGTTATTCAGTGTGCGTTCCTCTCCTACGGGAACCACTGGCCAGAAGGCAA

AGTAAGTCTGACTGCATTGGAGATTTTCGTTCTTGT
Translation
MASVVEYKGLKAGYYCGYCESREGKTSCG - UNI33293 - GMWAHSMTVQDYQDLIDRGWRR RSGKYVYKPVMDQTCCPQYTIR RCHPLQFQPSK

SHKKVLKKMLKFLAKGEISKGNCED - UNI27379 - DEPMDSTVEDAVDGDFALINKLDIKCDLKTLSDLKGSIESEEKEKEKSIKKEGSKEFIHPQ

SIEEKLGSGEPSHPIKVHIGPKPG GKGADLSKPPCRKAREMRKERQRLKRMQQASAAASEAQGQPVCLLPKAKSNQPKSLEDLIFQSLPENASHKLE V

RVVRSSPPSPQFRATFQESYQVYKRYQMVVHKDPPDKPTVSQ - UNI21799 - FTRFLCSSPLE AEHPADGPECGYGSFHQQYWLDGKIIAVGVLD

ILPYCVSSVYLYYDPDYSFLSLGVYSALR REIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYK - UNI4228 - GQYRPSDLLCPETYVWVPIEQCL

PSLDNSKYCRFNQDPEAE - UNI5085 - EDEGRSKELDRLRVFHRRSAMPYGVYKNHQEDPSEEAGVLEYANLVGQKCSERMLLFRH
Transcript ENSMUST00000033139
Sequence
GTGGGGTGGTGGAGGCGAAGGCGGCGGTAGCGGCGGCTGCGTAGGACTGGGTGGCGCAGCGGCGGCGGGGTCGCGGACATGGCTTCTTGGAGCGCGCCTT

CACCTAGCCTTGTAGAGTATTTTGAGGGCCAGACCTCCTTCCAGTGTGGCTACTGCAAGAACAAGTTGGGCAGTCGCTCCTATG - UNI33293 - GC

ATGTGGGCACATTCCATGACAGTGCAGGATTATCAGGATCTTATAGACCGAGGATGGAGAAG AAGTGGGAAATATGTGTACAAACCTGTCATGGATCAA

ACATGCTGTCCTCAGTATACAATAAG GTGTCATCCTTTACAGTTTCAGCCATCAAAATCTCACAAGAAAGTTTTGAAAAAAATGCTGAAATTTCTGGCT

AAAGGAGAGATCTCGAAAGGCAATTGTGAGG - UNI27379 - ATGAGCCCATGGATTCTACAGTGGAGGATGCTGTTGACGGTGACTTTGCATTAAT

TAACAAGCTGGATATAAAGTGTGATCTCAAAACACTCAGTGACCTCAAAGGAAGCATAGAGAGTGAAGAGAAGGAGAAAGAAAAGAGTATAAAGAAAGAA

GGGTCTAAAGAATTCATTCATCCACAATCTATAGAGGAGAAGTTGGGCTCTGGTGAACCATCACATCCAATCAAAGTTCATATTGGTCCTAAGCCAG GC

AAAGGGGCTGACTTGAGTAAGCCTCCATGTCGGAAAGCAAGGGAAATGAGGAAAGAAAGGCAAAGATTAAAACGGATGCAGCAGGCCTCAGCTGCAGCCT

CGGAGGCTCAAGGTCAGCCAGTCTGTTTGTTACCAAAGGCTAAATCCAACCAGCCCAAGTCACTGGAAGATTTGATTTTTCAATCTTTACCAGAAAATGC

ATCGCACAAGTTAGAG GTGAGGGTGGTAAGATCTTCTCCACCAAGTCCTCAGTTCAGAGCCACATTTCAGGAGTCTTACCAGGTCTATAAACGCTACCA

GATGGTTGTTCACAAGGACCCGCCTGATAAGCCAACCGTGAGCCAG - UNI21799 - TTTACAAGATTCCTTTGCAGCTCACCATTGGAG GCAGAG

CACCCTGCTGATGGACCAGAATGTGGTTATGGCTCCTTTCACCAGCAGTACTGGCTCGATGGGAAGATCATTGCTGTGGGGGTGTTAGACATTCTCCCGT

ACTGTGTGTCTTCTGTGTATCTCTACTACGATCCTGATTATTCATTTCTGTCTTTGGGTGTCTATTCAGCATTAAG AGAAATTGCTTTTACTAGACAAC

TGCATGAGAAAACATCGCAACTCAGCTATTATTATATGGGTTTCTACATTCATTCCTGTCCCAAGATGAGATACAAG - UNI4228 - GGTCAATATA

GACCTTCTGATTTGCTGTGTCCTGAGACGTATGTCTGGGTGCCCATTGAGCAGTGCCTGCCTTCTCTGGACAACTCCAAGTACTGCCGTTTCAACCAGGA

CCCCGAAGCAG - UNI5085 - AGGATGAAGGACGCAGTAAGGAACTTGACCGACTAAGGGTGTTTCACAGACGATCTGCCATGCCTTACGGTGTTTA

TAAGAATCACCAAGAAGACCCAAGTGAGGAGGCTGGTGTGCTGGAGTATGCAAACCTCGTAGGACAGAAGTGCTCGGAGAGGATGCTGCTGTTCAGACAC

TGAAGGCCTGCACCTCAGCCCAGCGCCAGCCTGGCATCTCTTGCCACAGTCCCACCTGCTTCTCGGCTCCTGCAGCCATTCACCAAGTACATTCGTAGAG

CTTTTTAAAAATATTTTGTGGAATTGTATTTATGAGAATCTTGTGGTTAATATAAAGATTTTAAAATATTCTATGACCTAGCCCTTTAATTGGGACTTGT

CCTTTGCAGCTTGCTTCTGGAGCAAGGTGTGCTTCATGTCTCCAGTGAATATTTAGGGAAGGAAAATGAAGAAGTCAATATAAGTCATTTTGTCACAGTT

ACTGTTCTGTGCTGGAGAAATTCTGACACAGAGACTGTTCTTTTAGACCAATGGTTCTTAACCTGTGGGCTCACCACACTCACAGGCCGAATGTTAGATA

GCCTGTGTGAGATCAACTCATAATAACTCATAATCGTAGCAAAATTACAGTTATGAAGTAGCAACAAAATAATTTTATGGTTTGGGGTGGGATCACCACA

ACGTGAGGAAATGTATTAAAGGATGGCAGTATTAGGAAGGTAGAGAAAGAACCACTGGCTAAGACCCATGCAAGACATTAGCTTATGCTGGGAAATTCAG

ATGGGCTTAAAGGTGAAGAGCACATTCCATCCCAGGAAATGTGCCTTTCCCACAAACCAGAACCCTGTTACTCTGCTTGATAGTAAACCTGCCAGTGTTG

TAGTGTATAATAGACAACAGGAACTGTAAACATTGCAAACATCAGGTGTTCACTTTGGGTGTCTGTCCAGGACTGTCCTGCCTATGTCTGTTGTCTTGGC

ATAATTGTTTTCCTTGTCACTAGTGTTCCCTTGTGCCCCAGAGTTATCTCTGTTTGGATGATAAAATATGCAGTGATCTTAGTGGTGTTTGTTCTATTTC

TACAAATATAAGAAACAACTTTCTAAAGAAACGTCGTAACTCCTGCTTGATCTGAGGCTTATCCAAAGAAAATAGCTTCCTACTTTCCATTCTCTGGAAC

TCAGACGCTTTTTTGTGGTTAGTGATAGAAGTGATTATTATCTAGTCCCGTAGCTATGCACAGCCGTAGTGGAGTTGGTGGGGCCTCTAGCCTCTGCATT

CCTCTTCTAGTTGTGGGTCAGAGAGTAGGCGCTGCCATGGTACTTCAGAATGGAGACCAGCCATTCACTTTCATTCTTGTGCTGTTGGGCCTTCTGCTTG

TTCACCAAATGCCTGCTGTCAAGGAGGCAGGCAGCCAGCTACTTCGTGAGGCACATCAGACCTGGTGAGGAGAGGCTTCCCTCAGGTGCTCGGGAAGCTG

GATGCACAGGTTAGCCCTTTGTTTGAACTTGTTCTCAGCTAGCCCCTTCTAGAAGTGCTTCCAAGCCTGGCCTTGGAGCTGCTGAGAGCACCTATCCCAC

AGTGAGGGTAGGGTTGTTACTTTATTTCTTTTCATAAAAATCACTCCAATGGGAAGCACCTGGAACGCTAAGAAATTAAAAGTCGTTTGAAATCCTCCCA

GGCATAGAGAAAGGAGCATTATGGAAACCCACAAATCTCTTGTCCACCCCAAATAAAACTGTGCATTCCTTGCTATGTAGTTGCCCTCGGTGAATGTGTG

TGAGATTGAAGATTGCAGAAGATGTGATAGGTAATCTCAGTATTCTTCAGTAGGATGGGATCACATATATGACCTTGGCATTGGGCAGCCAGGCATATCC

TGGTAGGTGGTATAGCCATGCTACCAGAGGGGTTTGTTTTTGGGAGGGGGCGGGGGGTCAGCCCAACATCTTACCCTAGCTCTGAGTTTCTCCTGCAGAG

AATAGAGGAAAATGGCTCACTGTCCCTGTTTCTAGACTGATGCGCCTAACCTAGGGTGGCCCTACTGAGGCTTCAGAGCGTCTTGGGCATGAAAACTCTC

TCTTCAGCTCAGTTGCTTTGTATTCATTCTTTCCTCCCTCCTCCCTCTATCCTCTCCTCAATACAGTTTTTTTCGACTAGTATGAAACCTTAGGGTTCTA

GATGTTGTCGAAGATGTGTCCTTGGGTGGGACTGAGGAGATAGCCCAGTTAGTACAGTGCCTGAGTTCAGTTCTCTAGAGCCCATGTAAAATGTTGGGTC

TGGTAGTGTGTGTTTGAAATGCAGGCACTGGGGATTCAGTAGAGGAGTACCTCTTGGGCCCACTGGCCACTGGCCTAGCCACTGGGCATCGAGCCACTGA

GAGACCCTGTCTAAATGGAGTTGGACAGCATTTATGAGAACATTAGGGGCTTGCTAATATTTTGAGCTCTTGAGTGAGTGTCCATCACAGCTCGGTTAGG

ACAGTCAAGAAAGTATCCCAACTTGGCATTTTTGTAAAGTCTCGCTGAGGCGGCTGATTCTGTCAGTGATTTTCATGTAAATAAAGATGCGTGCAAGCCT

TTCAGGGACAGTGTCTGACTTCTCCAGGTAGGAAGGTCTGTGTGTTCCATCTCCTTCTTAGTGTCCCCTTCTGAGTTCAGGTAGAGTCACACCTTCCTCC

ATGCCTACAGCGTAGGGCTCATTTTGATTCTCAGTGTACCATCTTTATTTAAATTATTTTCAGTTCTCTGAGACTTTTGTTACTTTTATTACAGGTAATC

TGAGCACTTTTATATTCTAAGATAGAAACTATATTATCAGATGAATATAGTCACTCAATTAAAATTATTTAGATAAAATTATTGTTTATGTTTTCTTTCA

AGCAATCTATCCTATTTTTATCCATTTGCAAATGCCAGTTTTGTGTGGTTTCTTAGCATATCAAAATTATTATGTAGAAGAATGTTTCTAGCTTTCTGAA

CAGCAAATAGTTTGGTGTGTAAATATTGTATTATTTCAGTGTGAATAAAGGTGAGAGAGAATATGAACATTTAACCAAAGTGATTCTACTGTGGCTGACT

TAAAAGAACGGAAGGAAGTGAGTGGGGATTTGACACGTTTGAATTACGAGTTATTCAGTGTGCGTTCCTCTCCTACGGGAACCACTGGCCAGAAGGCAAA

GTAAGTCTGACTGCATTGGAGATTTTCGTTCTTGT
Translation
MASWSAPSPSLVEYFEGQTSFQCGYCKNKLGSRSYG - UNI33293 - GMWAHSMTVQDYQDLIDRGWRR RSGKYVYKPVMDQTCCPQYTIR RCHP

LQFQPSKSHKKVLKKMLKFLAKGEISKGNCED - UNI27379 - DEPMDSTVEDAVDGDFALINKLDIKCDLKTLSDLKGSIESEEKEKEKSIKKEGS

KEFIHPQSIEEKLGSGEPSHPIKVHIGPKPG GKGADLSKPPCRKAREMRKERQRLKRMQQASAAASEAQGQPVCLLPKAKSNQPKSLEDLIFQSLPENA

SHKLE VRVVRSSPPSPQFRATFQESYQVYKRYQMVVHKDPPDKPTVSQ - UNI21799 - FTRFLCSSPLE AEHPADGPECGYGSFHQQYWLDGKI

IAVGVLDILPYCVSSVYLYYDPDYSFLSLGVYSALR REIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYK - UNI4228 - GQYRPSDLLCPETYVW

VPIEQCLPSLDNSKYCRFNQDPEAE - UNI5085 - EDEGRSKELDRLRVFHRRSAMPYGVYKNHQEDPSEEAGVLEYANLVGQKCSERMLLFRH
Transcript ENSMUST00000035458
Sequence
GTGGGGTGGTGGAGGCGAAGGCGGCGGTAGCGGCGGCTGCGTAGGACTGGGTGGCGCAGCGGCGGCGGGGTCGCGGACATGGCTTCTTGGAGCGCGCCTT

CACCTAGCCTTGTAGAGTATTTTGAGGGCCAGACCTCCTTCCAGTGTGGCTACTGCAAGAACAAGTTGGGCAGTCGCTCCTATG - UNI33293 - GC

ATGTGGGCACATTCCATGACAGTGCAGGATTATCAGGATCTTATAGACCGAGGATGGAGAAG AAGTGGGAAATATGTGTACAAACCTGTCATGGATCAA

ACATGCTGTCCTCAGTATACAATAAG GTGTCATCCTTTACAGTTTCAGCCATCAAAATCTCACAAGAAAGTTTTGAAAAAAATGCTGAAATTTCTGGCT

AAAGGAGAGATCTCGAAAGGCAATTGTGAGG - UNI27379 - ATGAGCCCATGGATTCTACAGTGGAGGATGCTGTTGACGGTGACTTTGCATTAAT

TAACAAGCTGGATATAAAGTGTGATCTCAAAACACTCAGTGACCTCAAAGGAAGCATAGAGAGTGAAGAGAAGGAGAAAGAAAAGAGTATAAAGAAAGAA

GGGTCTAAAGAATTCATTCATCCACAATCTATAGAGGAGAAGTTGGGCTCTGGTGAACCATCACATCCAATCAAAGTTCATATTGGTCCTAAGCCAG GC

AAAGGGGCTGACTTGAGTAAGCCTCCATGTCGGAAAGCAAGGGAAATGAGGAAAGAAAGGCAAAGATTAAAACGGATGCAGCAGGCCTCAGCTGCAGCCT

CGGAGGCTCAAGGTCAGCCAGTCTGTTTGTTACCAAAGGCTAAATCCAACCAGCCCAAGTCACTGGAAGATTTGATTTTTCAATCTTTACCAGAAAATGC

ATCGCACAAGTTAGAG GTGAGGCTAGTACCTGCCTCCTTTGAGGACCCAGAGTTCAACTCATCCTTCAACCAGTCCTTTTCTTTATATACCAAGTATCA

AGTGGCTATACACCAGGAAGCACCTGAAATATGTGAAAAGTCTGAG - UNI21799 - TTTACAAGATTCCTTTGCAGCTCACCATTGGAG GCAGAG

CACCCTGCTGATGGACCAGAATGTGGTTATGGCTCCTTTCACCAGCAGTACTGGCTCGATGGGAAGATCATTGCTGTGGGGGTGTTAGACATTCTCCCGT

ACTGTGTGTCTTCTGTGTATCTCTACTACGATCCTGATTATTCATTTCTGTCTTTGGGTGTCTATTCAGCATTAAG AGAAATTGCTTTTACTAGACAAC

TGCATGAGAAAACATCGCAACTCAGCTATTATTATATGGGTTTCTACATTCATTCCTGTCCCAAGATGAGATACAAG - UNI4228 - GGTCAATATA

GACCTTCTGATTTGCTGTGTCCTGAGACGTATGTCTGGGTGCCCATTGAGCAGTGCCTGCCTTCTCTGGACAACTCCAAGTACTGCCGTTTCAACCAGGA

CCCCGAAGCAG - UNI5085 - AGGATGAAGGACGCAGTAAGGAACTTGACCGACTAAGGGTGTTTCACAGACGATCTGCCATGCCTTACGGTGTTTA

TAAGAATCACCAAGAAGACCCAAGTGAGGAGGCTGGTGTGCTGGAGTATGCAAACCTCGTAGGACAGAAGTGCTCGGAGAGGATGCTGCTGTTCAGACAC

TGAAGGCCTGCACCTCAGCCCAGCGCCAGCCTGGCATCTCTTGCCACAGTCCCACCTGCTTCTCGGCTCCTGCAGCCATTCACCAAGTACATTCGTAGAG

CTTTTTAAAAATATTTTGTGGAATTGTATTTATGAGAATCTTGTGGTTAATATAAAGATTTTAAAATATTCTATGACCTAGCCCTTTAATTGGGACTTGT

CCTTTGCAGCTTGCTTCTGGAGCAAGGTGTGCTTCATGTCTCCAGTGAATATTTAGGGAAGGAAAATGAAGAAGTCAATATAAGTCATTTTGTCACAGTT

ACTGTTCTGTGCTGGAGAAATTCTGACACAGAGACTGTTCTTTTAGACCAATGGTTCTTAACCTGTGGGCTCACCACACTCACAGGCCGAATGTTAGATA

GCCTGTGTGAGATCAACTCATAATAACTCATAATCGTAGCAAAATTACAGTTATGAAGTAGCAACAAAATAATTTTATGGTTTGGGGTGGGATCACCACA

ACGTGAGGAAATGTATTAAAGGATGGCAGTATTAGGAAGGTAGAGAAAGAACCACTGGCTAAGACCCATGCAAGACATTAGCTTATGCTGGGAAATTCAG

ATGGGCTTAAAGGTGAAGAGCACATTCCATCCCAGGAAATGTGCCTTTCCCACAAACCAGAACCCTGTTACTCTGCTTGATAGTAAACCTGCCAGTGTTG

TAGTGTATAATAGACAACAGGAACTGTAAACATTGCAAACATCAGGTGTTCACTTTGGGTGTCTGTCCAGGACTGTCCTGCCTATGTCTGTTGTCTTGGC

ATAATTGTTTTCCTTGTCACTAGTGTTCCCTTGTGCCCCAGAGTTATCTCTGTTTGGATGATAAAATATGCAGTGATCTTAGTGGTGTTTGTTCTATTTC

TACAAATATAAGAAACAACTTTCTAAAGAAACGTCGTAACTCCTGCTTGATCTGAGGCTTATCCAAAGAAAATAGCTTCCTACTTTCCATTCTCTGGAAC

TCAGACGCTTTTTTGTGGTTAGTGATAGAAGTGATTATTATCTAGTCCCGTAGCTATGCACAGCCGTAGTGGAGTTGGTGGGGCCTCTAGCCTCTGCATT

CCTCTTCTAGTTGTGGGTCAGAGAGTAGGCGCTGCCATGGTACTTCAGAATGGAGACCAGCCATTCACTTTCATTCTTGTGCTGTTGGGCCTTCTGCTTG

TTCACCAAATGCCTGCTGTCAAGGAGGCAGGCAGCCAGCTACTTCGTGAGGCACATCAGACCTGGTGAGGAGAGGCTTCCCTCAGGTGCTCGGGAAGCTG

GATGCACAGGTTAGCCCTTTGTTTGAACTTGTTCTCAGCTAGCCCCTTCTAGAAGTGCTTCCAAGCCTGGCCTTGGAGCTGCTGAGAGCACCTATCCCAC

AGTGAGGGTAGGGTTGTTACTTTATTTCTTTTCATAAAAATCACTCCAATGGGAAGCACCTGGAACGCTAAGAAATTAAAAGTCGTTTGAAATCCTCCCA

GGCATAGAGAAAGGAGCATTATGGAAACCCACAAATCTCTTGTCCACCCCAAATAAAACTGTGCATTCCTTGCTATGTAGTTGCCCTCGGTGAATGTGTG

TGAGATTGAAGATTGCAGAAGATGTGATAGGTAATCTCAGTATTCTTCAGTAGGATGGGATCACATATATGACCTTGGCATTGGGCAGCCAGGCATATCC

TGGTAGGTGGTATAGCCATGCTACCAGAGGGGTTTGTTTTTGGGAGGGGGCGGGGGGTCAGCCCAACATCTTACCCTAGCTCTGAGTTTCTCCTGCAGAG

AATAGAGGAAAATGGCTCACTGTCCCTGTTTCTAGACTGATGCGCCTAACCTAGGGTGGCCCTACTGAGGCTTCAGAGCGTCTTGGGCATGAAAACTCTC

TCTTCAGCTCAGTTGCTTTGTATTCATTCTTTCCTCCCTCCTCCCTCTATCCTCTCCTCAATACAGTTTTTTTCGACTAGTATGAAACCTTAGGGTTCTA

GATGTTGTCGAAGATGTGTCCTTGGGTGGGACTGAGGAGATAGCCCAGTTAGTACAGTGCCTGAGTTCAGTTCTCTAGAGCCCATGTAAAATGTTGGGTC

TGGTAGTGTGTGTTTGAAATGCAGGCACTGGGGATTCAGTAGAGGAGTACCTCTTGGGCCCACTGGCCACTGGCCTAGCCACTGGGCATCGAGCCACTGA

GAGACCCTGTCTAAATGGAGTTGGACAGCATTTATGAGAACATTAGGGGCTTGCTAATATTTTGAGCTCTTGAGTGAGTGTCCATCACAGCTCGGTTAGG

ACAGTCAAGAAAGTATCCCAACTTGGCATTTTTGTAAAGTCTCGCTGAGGCGGCTGATTCTGTCAGTGATTTTCATGTAAATAAAGATGCGTGCAAGCCT

TTCAGGGACAGTGTCTGACTTCTCCAGGTAGGAAGGTCTGTGTGTTCCATCTCCTTCTTAGTGTCCCCTTCTGAGTTCAGGTAGAGTCACACCTTCCTCC

ATGCCTACAGCGTAGGGCTCATTTTGATTCTCAGTGTACCATCTTTATTTAAATTATTTTCAGTTCTCTGAGACTTTTGTTACTTTTATTACAGGTAATC

TGAGCACTTTTATATTCTAAGATAGAAACTATATTATCAGATGAATATAGTCACTCAATTAAAATTATTTAGATAAAATTATTGTTTATGTTTTCTTTCA

AGCAATCTATCCTATTTTTATCCATTTGCAAATGCCAGTTTTGTGTGGTTTCTTAGCATATCAAAATTATTATGTAGAAGAATGTTTCTAGCTTTCTGAA

CAGCAAATAGTTTGGTGTGTAAATATTGTATTATTTCAGTGTGAATAAAGGTGAGAGAGAATATGAACATTTAACCAAAGTGATTCTACTGTGGCTGACT

TAAAAGAACGGAAGGAAGTGAGTGGGGATTTGACACGTTTGAATTACGAGTTATTCAGTGTGCGTTCCTCTCCTACGGGAACCACTGGCCAGAAGGCAAA

GTAAGTCTGACTGCATTGGAGATTTTCGTTCTTGT
Translation
MASWSAPSPSLVEYFEGQTSFQCGYCKNKLGSRSYG - UNI33293 - GMWAHSMTVQDYQDLIDRGWRR RSGKYVYKPVMDQTCCPQYTIR RCHP

LQFQPSKSHKKVLKKMLKFLAKGEISKGNCED - UNI27379 - DEPMDSTVEDAVDGDFALINKLDIKCDLKTLSDLKGSIESEEKEKEKSIKKEGS

KEFIHPQSIEEKLGSGEPSHPIKVHIGPKPG GKGADLSKPPCRKAREMRKERQRLKRMQQASAAASEAQGQPVCLLPKAKSNQPKSLEDLIFQSLPENA

SHKLE VRLVPASFEDPEFNSSFNQSFSLYTKYQVAIHQEAPEICEKSE - UNI21799 - FTRFLCSSPLE AEHPADGPECGYGSFHQQYWLDGKI

IAVGVLDILPYCVSSVYLYYDPDYSFLSLGVYSALR REIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYK - UNI4228 - GQYRPSDLLCPETYVW

VPIEQCLPSLDNSKYCRFNQDPEAE - UNI5085 - EDEGRSKELDRLRVFHRRSAMPYGVYKNHQEDPSEEAGVLEYANLVGQKCSERMLLFRH

For any suggestions or comments, please send an email to unitrap@crg.es