Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000030994 (D7Ertd443e)
Chromosomal location
Chr 7: 141457945 - 141568511 (-)
Description
Putative uncharacterized proteinMCG125306, isoform CRA_a ; [Source:UniProtKB/TrEMBL;Acc:Q9D4E0]
Human Ortholog
not available
Omim not available
UniTrap UNI35107
Vector Insertion
Chr 7: 141490827 - 141541512
Public Clones IST12346B8 (tigm) IST13665E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094002
Sequence
TACAGAAGAAGAGAGGCCCTGACAGGGTCAGAATGCTGAAGTCAGAGCTGGTGGCCAGCCTTCCAGTGTTCAACACACTCCTGGGAGCCTTACCTCCACA

AGCCCAGGCTGA - UNI35107 - GAGACACTGGCATCACAGAACACAAGAATGATATCACCTGTGGTCATTTCCCGGCTGATTGATGAAAAGAAATC

TATGGAAAATGGAGCAATATTGCCACAAGCCATTGCTCAGCCTCAGCTGTGTCCCACAAAGCCAGCTTTGGCCAGGCGCGATGGAGTGAGCATGCACAGG

CGATTTGCTTTATCTCCAGACAGACTGGGAATTTTGACTCCATCAGATGATCAAGGACTGGAGACAGAACCGCTGTCTACAGGGGACAATCTAGGCAAAG

GTTCCCACAGCGGTTTCTCGTCTATCACCATTACTGCCCGACGTGTGGGCCCTCCAGCCAGCAGCTTGGTATGGGACACTTTTAGGGACCCACTGTGTCC

CAAGTGCAAAGCCAAGGATGCTCTGTTCCAAGAGCCCCCAGTTCTGGCTGGTGATGCCCATCTCTGTCAGCACAATAGACCCTTCACCTGTACAGAGTCC

CCCAGCAATGGCTCCGTAGAGGGGATGAAGGTTTTCCAGGCTCACTCAAGGCTGAGTGCAAGGCAGGACTACTGGGTCACCCACACGAATGACAATGAGG

ACAGTTTTTCTTCAGACAATTCACCATCGAGAAAAGTCCCACTGGTGTTCAGTTCTTGTGTCCACTTCCGGGTGTCTCAGCAGTGTCCCAATGCCATTTA

CTATTTGGACAAGTCTCTTTCTGTTCCCCTTGAGCGACCTCAAATTGCTAGCCCCAAAATGCACAGGTCTGTCCTGTCTCTCAGCCTCCGCTGTAGTTCC

CACCAGTTAACAGCAGATGGAGTAGACAGCTCAGCTAATGGAGAGCCAATCAGCACAGCTCTATCACAGGAACTCTCGGAGGGAAAGCAGGACCTCCTAG

GTCCACAATGGGGCCAGCCACAAGGTGGTCACTGGAAGGAGAGCCCAGCATTGGTGCCAGTACATTTGGGGAGTGGCACATGCCCTCGGACTGGCTCCCC

TCCACTGGAAAATGTCAAATTTGCAGACGTGGGAAGGAACCAGGTCCCAGTACGAAAGGAGAAAGAGGACCATGCAACATGTACCAGTAGCAGCCACACC

AACCAACTCTCCATCCATATTCCCGGCTGGAGTTACAGGGCTG - UNI35107 - AAACAAAAGTACTTTCTGGAAGCAAGAAGCAGCAGCAAGAAGC

ACAAAGAACTCTTCCTGCTTTCCCAGTGGGACAGAAGACCATTAAACACTTCCCTCCTGAAGGGGACAGTTCACCAAGCAGTGATGGTCAACCTAGCATC

CTTTCAGAGTCCAATGAGAGGCAACACCCATACTTCATGATACCCAGAGTCCCTCTGCCTGGGTTTTATTGCCCTTTACAAACTGGGTGTGCCTCTCTGC

AGGAAGATGGTGCTGTTCAGATAGAAACACACTTCCCCAAAG ATTACACGTGCTGTGACTTGGTTGTAAAACTAAAGGAATGTGAGAAGAACGAAGACC

CCACTGTCACCCCTGAGCCCTCACCAGCAACCCCCTCTCCATCAACCCCAGAGGGAGCACAGAGCTCTGACCCATCAGAAGATAGTTACGAGCCTCTGCT

GGCAAGTTCTATGACTTTGCAG GAAGCACTGGAAGTCCATAGACCTCAGTTCATTTCTCGCTCACAAGAACGGCTGCAAAAGCTTAAGCGCATGGTACA

GCAAAGGAAAACCCAACAAAAGGAGAGCCTGGGGCAGAAGCAGAGCCTACTTCCTGTCCGCGCCAACAAGAAGCAGTTCACCATTCCCCATCCTCTTAGT

G ATAACTTGTTCAAACCCAAAGAAAGATGCATTTCAGAGAAGGAGATGCATATGAGATCTAAAAG AATCTATAATAATTTGCCGGAAGTTAAAAAGAA

AAAAGAAGAGCAGAAGAAAAGAATGATCTTACAGAGTAACCGGCTCCGAGCAGAAGTCTTCAAAAAG CAATTACTGGACCAGCTCCTTCAAAGGAATGC

AGTTTGATCCCAGGTGGCTCTGCTAGCCCTGGATCTGGGAACACTTCTGACGACGACGCTGGATGGATGAACCATTACATTTAACACTATCTCCACACGT

GCAAGACACCTTTACTTTACTCCTGATTTTTCTTTTTCCCACAAAGGAAATGTCACTTTCTGAATGTCCCAAACAGAAGCAACAGTCCGGCAGGCAATGG

ATCAGCAGTCCATTGCTGGGACTTCAACACCTCGGGACCTACCAGATTTAGTCCCTTCCAACTTCCTTGGCTTGTGAATTTTACCCATTGCTTCTGAAGT

TTCCATTGTACCAATTCCACCCAAGCAGGAAAGCTTCATATACTCACGTGTGCTTGGA
Translation
 - UNI35107 - MISPVVISRLIDEKKSMENGAILPQAIAQPQLCPTKPALARRDGVSMHRRFALSPDRLGILTPSDDQGLETEPLSTGDNLGKGSHS

GFSSITITARRVGPPASSLVWDTFRDPLCPKCKAKDALFQEPPVLAGDAHLCQHNRPFTCTESPSNGSVEGMKVFQAHSRLSARQDYWVTHTNDNEDSFS

SDNSPSRKVPLVFSSCVHFRVSQQCPNAIYYLDKSLSVPLERPQIASPKMHRSVLSLSLRCSSHQLTADGVDSSANGEPISTALSQELSEGKQDLLGPQW

GQPQGGHWKESPALVPVHLGSGTCPRTGSPPLENVKFADVGRNQVPVRKEKEDHATCTSSSHTNQLSIHIPGWSYRAE - UNI35107 - ETKVLSGS

KKQQQEAQRTLPAFPVGQKTIKHFPPEGDSSPSSDGQPSILSESNERQHPYFMIPRVPLPGFYCPLQTGCASLQEDGAVQIETHFPKD DYTCCDLVVKL

KECEKNEDPTVTPEPSPATPSPSTPEGAQSSDPSEDSYEPLLASSMTLQ EALEVHRPQFISRSQERLQKLKRMVQQRKTQQKESLGQKQSLLPVRANKK

QFTIPHPLSD DNLFKPKERCISEKEMHMRSKR RIYNNLPEVKKKKEEQKKRMILQSNRLRAEVFKK QLLDQLLQRNAV
Transcript ENSMUST00000106129
Sequence
CTGCCAG - UNI35107 - GGTCAG AAACAAAAGTACTTTCTGGAAGCAAGAAGCAGCAGCAAGAAGCACAAAGAACTCTTCCTGCTTTCCCAGTGG

GACAGAAGACCATTAAACACTTCCCTCCTGAAGGGGACAGTTCACCAAGCAGTGATGGTCAACCTAGCATCCTTTCAGAGTCCAATGAGAGGCAACACCC

ATACTTCATGATACCCAGAGTCCCTCTGCCTGGGTTTTATTGCCCTTTACAAACTGGGTGTGCCTCTCTGCAGGAAGATGGTGCTGTTCAGATAGAAACA

CACTTCCCCAAAG ATTACACGTGCTGTGACTTGGTTGTAAAACTAAAGGAATGTGAGAAGAACGAAGACCCCACTGTCACCCCTGAGCCCTCACCAGCA

ACCCCCTCTCCATCAACCCCAGAGGGAGCACAGAGCTCTGACCCATCAGAAGATAGTTACGAGCCTCTGCTGGCAAGTTCTATGACTTTGCAG GAAGCA

CTGGAAGTCCATAGACCTCAGTTCATTTCTCGCTCACAAGAACGGCTGCAAAAGCTTAAGCGCATGGTACAGCAAAGGAAAACCCAACAAAAGGAGAGCC

TGGGGCAGAAGCAGAGCCTACTTCCTGTCCGCGCCAACAAGAAGCAGTTCACCATTCCCCATCCTCTTAGTG ATAACTTGTTCAAACCCAAAGAAAGAT

GCATTTCAGAGAAGGAGATGCATATGAGATCTAAAAG AATCTATAATAATTTGCCGGAAGTTAAAAAGAAAAAAGAAGAGCAGAAGAAAAGAATGATCT

TACAGAGTAACCGGCTCCGAGCAGAAGTCTTCAAAAAG CAATTACTGGACCAGCTCCTTCAAAGGAATGCAGTTTGATCCCAGGTGGCTCTGCTAGCCC

TGGATCTGGGAACACTTCTGACGACGACGCTGGATGGATGAACCATTACATTTAACACTATCTCCACACGTGCAAGACACCTTTACTTTACTCCTGATTT

TTCTTTTTCCCACAAAGGAAATGTCACTTTCTGAATGTCCCAAACAGAAGCAACAGTCCGGCAGGCAATGGATCAGCAGTCCATTGCTGGGACTTCAACA

CCTCGGGACCTACCAGATTTAGTCCCTTCCAACTTCCTTGGCTTGTGAATTTTACCCATTGCTTCTGAAGTTTCCATTGTACCAATTCCACCCAAGCAGG

AAAGCTTCATATACTCACGTGTGCTTGGA
Translation
LPG - UNI35107 - GSE ETKVLSGSKKQQQEAQRTLPAFPVGQKTIKHFPPEGDSSPSSDGQPSILSESNERQHPYFMIPRVPLPGFYCPLQTGCA

SLQEDGAVQIETHFPKD DYTCCDLVVKLKECEKNEDPTVTPEPSPATPSPSTPEGAQSSDPSEDSYEPLLASSMTLQ EALEVHRPQFISRSQERLQKL

KRMVQQRKTQQKESLGQKQSLLPVRANKKQFTIPHPLSD DNLFKPKERCISEKEMHMRSKR RIYNNLPEVKKKKEEQKKRMILQSNRLRAEVFKK QL

LDQLLQRNAV

For any suggestions or comments, please send an email to unitrap@crg.es