Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031010 (Usp9x)
Chromosomal location
Chr X: 12648624 - 12766815 (+)
Description
ubiquitin specific peptidase 9, X chromosome Gene [Source:MGI (curated);Acc:Usp9x-001]
RefSeq_dna
NM_009481 
RefSeq_peptide
NP_033507.2 
UniGene
Mm.242646 Mm.393209 Mm.401686 Mm.404990 Mm.408061 
MGI
MGI:894681 
Uniprot/SWISSPROT
P70398 
Uniprot/SPTREMBL
Q4FE56 Q8BR77 Q8BS89 Q8C7T5 A2AD18 
Human Ortholog
ENSG00000124486 (USP9X)
Omim not available
UniTrap UNI15532
Vector Insertion
Chr X: 12648860 - 12671041
Public Clones D042G12 (ggtc) P136F10 (ggtc) D042D04 (ggtc) CMHD-GT_461D9-3 (cmhd) PST9058-NR (escells)
IST14703H7 (tigm) IST10456G2 (tigm) IST15093H3 (tigm)
Private Clones OST447688 (lexicon) OST444532 (lexicon) OST443670 (lexicon) OST425189 (lexicon)
OST311313 (lexicon) OST268276 (lexicon) OST246613 (lexicon) OST246438 (lexicon)
OST226004 (lexicon) OST222932 (lexicon) OST208102 (lexicon) OST205835 (lexicon)
OST181609 (lexicon) OST172603 (lexicon) OST134570 (lexicon) OST132052 (lexicon)
OST66197 (lexicon) OST38572 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27370
Vector Insertion
Chr X: 12671304 - 12675575
Public Clones not available
Private Clones OST61483 (lexicon) OST54264 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26032
Vector Insertion
Chr X: 12675722 - 12677558
Public Clones not available
Private Clones OST144178 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23994
Vector Insertion
Chr X: 12677639 - 12680453
Public Clones CMHD-GT_462C6-3 (cmhd)
Private Clones OST238286 (lexicon) OST222501 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20398
Vector Insertion
Chr X: 12680567 - 12681708
Public Clones not available
Private Clones OST364466 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2
Vector Insertion
Chr X: 12685255 - 12687201
Public Clones GC0002 (tigem) XK141 (baygenomics) IST11297B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1775
Vector Insertion
Chr X: 12690893 - 12691633
Public Clones CF0308 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38209
Vector Insertion
Chr X: 12691771 - 12693749
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12342
Vector Insertion
Chr X: 12693884 - 12698558
Public Clones W059E04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35406
Vector Insertion
Chr X: 12698647 - 12700293
Public Clones IST14406G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3658
Vector Insertion
Chr X: 12700637 - 12701693
Public Clones CD0047 (sanger) CD0039 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10938
Vector Insertion
Chr X: 12702734 - 12705333
Public Clones D015D05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27599
Vector Insertion
Chr X: 12706253 - 12707351
Public Clones not available
Private Clones OST55732 (lexicon)
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15389
Vector Insertion
Chr X: 12707473 - 12708852
Public Clones PST7008-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI352
Vector Insertion
Chr X: 12709475 - 12712069
Public Clones GC0952 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 46% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12236
Vector Insertion
Chr X: 12713697 - 12714733
Public Clones A047F03 (ggtc)
Private Clones OST43459 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18666
Vector Insertion
Chr X: 12714901 - 12717234
Public Clones not available
Private Clones OST418535 (lexicon)
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10485
Vector Insertion
Chr X: 12728570 - 12731217
Public Clones D050B09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12284
Vector Insertion
Chr X: 12733874 - 12734794
Public Clones A045C01 (ggtc) A045B01 (ggtc)
Private Clones OST440366 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11535
Vector Insertion
Chr X: 12734919 - 12735844
Public Clones P023C05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29142
Vector Insertion
Chr X: 12736071 - 12736899
Public Clones not available
Private Clones OST7398 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1648
Vector Insertion
Chr X: 12737030 - 12737872
Public Clones DD0033 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20507
Vector Insertion
Chr X: 12738059 - 12738439
Public Clones not available
Private Clones OST360403 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12320
Vector Insertion
Chr X: 12738838 - 12741837
Public Clones F15284 (ggtc)
Private Clones OST436507 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2587
Vector Insertion
Chr X: 12742611 - 12743757
Public Clones XS0138 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7489
Vector Insertion
Chr X: 12743854 - 12746472
Public Clones RRR019 (baygenomics) PST24944-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16375
Vector Insertion
Chr X: 12746472 - 12750455
Public Clones not available
Private Clones OST462058 (lexicon) OST405684 (lexicon) OST31484 (lexicon) OST24397 (lexicon)
OST22801 (lexicon) OST16566 (lexicon) OST15238 (lexicon) OST13703 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34406
Vector Insertion
Chr X: 12746599 - 12746600
Public Clones IST12240A2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33227
Vector Insertion
Chr X: 12750455 - 12766663
Public Clones IST11303G8 (tigm) IST12400A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000089302
Sequence
GGGCGGTGCTGAGACTAGTGGGAGTCTGCGCTGCCGCTGCTGTTGCTGCCGCCGTCGCCGCCGCCTCCGACACTGCCACCGCCACCGCCACCACCACCGG

CCGTGCGGGTTTTCTTTCTTTTTCTTTCTGTCTTTTCTTTTCTTTCTTGATTTGTTGGGTTCGCCATATTGACGAGGCTGTGGTACCCAAGGCTGCGGAA

GCTAGAGTCCGCCGGTGGCGGAGCCGCAAGCTCTCG - UNI15532 - GTTATGCAATGGTCTCTGCAAGATGTTTTATTCTTGAATTGGAACCTTTT

ACGACTGACAAATGCTGGTACTTTATCTCCTATAAGTGGACTATAATTTCTTTTCTTAAGACAACTACATAAGCAGACAAAATTGCAAAGATCTGCCCTG

TGTCGAGTATGACAGCCACGACTCGTGGCTCTCCAGTTGGAGGGAATGACAACCAGGGCCAAGCCCCTGATGGACAGTCTCAGCCCCCCCTCCAACAGAA

TCAG - UNI27370 - ACTTCATCGCCTGATTCGTCCAATGAAAATTCCCCTGCAACTCCTCCTGATGAGCAAGGTCAAGGTGATGCTCCTCCACAGA

TTGAAGATGAGGAACCTGCATTTCCACACACTGACTTGGCAAAGTTAGATGATATGATCAACAG - UNI26032 - GCCTCGATGGGTTGTTCCAGTT

TTGCCGAAAGGGGAATTAGAAGTGCTTTTAGAAGCTGCTATTGATCTTAGTAAGAAAG - UNI23994 - GCCTTGATGTTAAAAGTGAAGCATGTCA

GCGATTTTTCCGAGATGGGCTAACGATCTCATTTACAAAAATCCTGACAGATGAAGCAGTGAGTGGCTGGAAGTTTGAAATTCAC - UNI20398 - A

GATGCATTATTAACAATACTCATCGCCTGGTGGAGCTATGTGTGGCTAAGTTAGCCCAAGACTGGTTTCCACTTCTAGAACTTCTTGCCATGGCCTTAAA

TCCTCATTGCAAATTCCATATCTACAATGGTACACGTCCCTGCGAGTCAGTGTCCTCAAGTGTTCAGTTGCCTGAAGATGAACTCTTTGCTCGTTCTCCA

GACCCTCGATCACCAAAA GGTTGGCTAGTGGATCTCCTCAACAAGTTTGGCACTTTAAATGGATTCCAGATACTGCACGATCGTTTTATTAATGGATCA

GCATTAAACGTTCAGATAATTGCAGCCCTTATTAA ACCATTTGGACAGTGCTATGAGTTTCTTACTCTTCACACAGTGAAAAAGTACTTTCTTCCAATA

ATAGAAATGGTTCCACAGTTTTTAGAAAACTTAACTGATGAAGAGCTGAAGAAAGAAGCAAAGAATGAAGCCAAAAATGATGCTCTTTCAATGATTATTA

AATCATTGAAGAATTTAGCTTCGCGGGTTCCTGGACAAGAAGAAACTGTAAAAAACTTAGAAATATTTAGGTTAAAAATGATACTTAG ATTGTTGCAAA

TTTCTTCTTTCAATGGAAAGATGAATGCACTGAATGAGGTTAATAAGGTGATTTCCAGTGTGTCATACTATACCCATCGGCATGGCAGTTCTGAGGATGA

AGAGTGGCTTACAGCAGAGAGGATGGCT - UNI2 - GAATGGATACAGCAGAACAATATTTTATCCATAGTTTTACGAGATAGCCTTCATCAACCACA

GTATGTAGAGAAACTAGAAAAGATTCTTCGCTTTGTCATAAAAGAAAAAGCTCTGACCTTGCAAGATCTTGATAATATCTGGGCAGCACAG GCAGGGAA

ACATGAAGCCATTGTAAAGAATGTACATGATCTACTGGCCAAATTGGCATGGGATTTTTCTCCTGAACAACTTGATCATCTTTTTGATTGCTTTAAG GC

CAGTTGGACAAATGCAAGTAAAAAGCAACGTGAAAAGCTCCTTGAGCTGATTCGTCGTCTTGCAGAAGATGATAAAGATGGTGTGATGGCACATAAAGTA

TTGAACCTTCTGTGGAATCTAGCTCACAGTGATGATGTGCCTGTAGATATCATGGATTTGGCTCTCAGTGCTCACATCAAAATACTAGATTATAGTTGCT

CCCAG - UNI1775 - GACCGGGACACCCAAAAGATCCAGTGGATTGATCGCTTCATAGAAGAACTTCGCACAAATGACAAATGGGTCATTCCTGCAC

TGAAACAAATTAGAGAAATTTGTAGTTTGTTTGGTGAAGCACCTCAAAATTTGAG TCAAAGTCAGCGAAGTCCCCATGTATTTTATCGCCATGACTTAA

TCAATCAACTTCAGCACAATCATGCCCTAGTTACTTTGGTAGCAGAAAACCTTGCAACTTACATGGAAAGCATGAGAATGTATGGCAGAG - UNI1234

2 - ACAATGAAGACTATGACCCACAAACTGTGAGACTGGGAAGTAGATATAGTCATGTTCAAGAAGTCCAAGAACGGCTTAACTTTCTTAG - UNI35

406 - GTTTTTATTGAAGGATGGCCAGCTGTGGCTGTGTGCTCCACAGGCAAAACAAATATGGAAGTGCTTAGCAGAGAATGCGGTTTATCTTTGTGAT

CGTGAAGCCTGTTTTAAGTGGTATTCCAAATTAATGGGAGACGAACCTGACTTAGATCCTGATATCAATAAGGACTTCTTTGAAAGTAATGTGCTTCAGC

TTGATCCTTCCCTGTTAACTGAAAATGGGATGAAGTGTTTTGAGAGATTCTTCAAAGCTGTGAATTGTCGAGAAGGAAAACTAGTAGCAAAAAGAAGAGC

CTACATGATGGATGATTTGGAATTGATAGGATTAGACTATCTTTGGAGA - UNI3658 - GTTGTAATTCAGAGTAATGATGATATTGCCTGCCGAGC

TATTGATCTCCTTAAAGAGATATACACAAACCTTGGTCCAAGGCTGCAGGTCAATCAG GTGGTGATCCATGAAGACTTCATTCAGTCTTGCTTTGATCG

TTTGAAAGCCTCTTATGACACATTGTGTGTTTTGGATGGTGACAAAGACAGTATTAATTGTGCAAGACAGGAAGCTGTTCGAATGGTCCGAGTGTTAACT

GTTCTAAGAGAATATATAAATGAATGTGACAGTGATTATCATGAAGAAAGAACAATTTTGCCTATGTCAAG - UNI10938 - AGCTTTCCGTGGTAA

ACACCTCTCTTTTATAGTTCGATTTCCAAACCAGGGCAGGCAAGTAGATGACTTGGAGGTTTGGTCTCATACAAATGATACCATTGGTTCAGTTCGAAGA

TGTATACTCAATCGTATTAAAGCCAATGTAGCTCATACAAAAATTGAACTCTTTGTGGGTGGTGAGCTTATTGATCCTGGAGATGACCGAAAGTTGATTG

GACAATTAAACCTAAAAGATAAATCA CTAATTACAGCCAAACTTACACAAATAAGCTCCAATATGCCTTCAAGTCCTGATAGCTCCTCTGATTCCTCAA

CTGGATCTCCTGGAAATCATGGTAATCATTACAGTGATGGCCCCAATCCAGAAGTGGAAAGTTGTTTGCCTGGAGTG - UNI27599 - ATAATGTCA

CTTCATCCCAGATACATCTCTTTCCTTTGGCAAGTTGCAGACTTAGGGAGCAGCCTAAATATGCCACCTCTTAGAGATGGAGCAAGAGTGCTTATGAAAC

TTATGCCGCCAG - UNI15389 - ATAGTACGACAATAGAAAAGTTAAGAGCTATTTGTTTGGACCATGCCAAACTTGGAGAAAGCAGCCTTAGTCCA

TCTCTTGACTCACTTTTCTTTGGTCCTTCAGCCTCACAAGTGCTATACCTAACAGAG GTAGTCTATGCCTTGTTAATGCCCGCTGGTGCACCCTTGACT

GATGATTCCTCGGATTTTCAGTTTCACTTCTTGAAAAGTGGTGGTCTGCCCCTTGTCCTGAGTATGCTAACCAGAAATAACTTCCTACCAAATGCAGATA

TGGAAACTCGAAGGGGTGCCTACCTCAATGCTCTTAAAATAGCCAAACTGTTACTAACTGCCATTGGCTATGGCCATGTTCGTGCTGTGGCAGAAGCTTG

TCAACCAGGTGTAGAAGGCGTGAATCCTATGACATCG - UNI352 - GTCAACCAAGTAACTCATGATCAAGCAGTGGTGCTACAAAGTGCCCTTCAG

AGCATTCCTAACCCATCATCTGAATGCATGCTTAGAAACGTGTCTGTTCGCCTTGCTCAGCAGATTTCTGATGAG GCTTCAAGATATATGCCTGATATT

TGTGTAATTAGAGCTATACAAAAAATTATTTGGACATCAGGATGTGGAGGATTACAGCTGGTATTCAGCCCAAATGAAGAAGTGACAAAAATTTATGAGA

AG - UNI12236 - ACCAATGCAGGCAATGAGCCAGACCTCGAAGATGAACAGGTTTGCTGTGAAGCATTGGAGGTGATGACACTGTGTTTCGCCTTG

ATTCCAACAGCCTTAGATGCTCTAAGTAAAGAAAAAGCTTGGCAGACATTTATTATTGACTTACTGTTGCACTGTCACAGCAA - UNI18666 - AAC

TGTTCGTCAAGTGGCACAGGAACAATTCTTCTTAATGTGCACCAGATGTTGCATGGGGCACAGGCCTCTACTTTTCTTCATTACGCTGCTCTTTACTGTT

TTGGGG AGCACAGCCAGAGAGAGGGCTAAACACTCAGGCGACTACTTTACTCTTTTAAGACATCTTCTTAATTACGCCTACAACAGTAACATTAATGTG

CCCAATGCTGAAGTTCTTCTAAATAATGAAATTGATTGGCTTAAAAGAATTAGG GATGATGTTAAAAGGACAGGTGAAACAGGTGTTGAGGAGACAATC

TTAGAAGGACACCTTGGGGTTACAAAGGAGCTACTGGCTTTTCAGACTCCTGAGAAAAAGTTTCATATTGGTTGTGAAAAGGGAGGTGCTAATCTCATTA

AA GAATTAATCGACGACTTCATCTTTCCCGCATCCAATGTTTACCTGCAGTATATGAGAAATGGAGAACTCCCTGCTGAGCAGGCCATTCCTGTGTGTG

GTTCACCAGCCACAATTAATGCTGGTTTTGAGTTACTTGTGGCATTAGCTGTTGGCTGTGTGAGGAACCTCAAACAGATAGTAGATTCTTTGACTGAAAT

GTATTACATTGGTACAGCAATAACTA CTTGTGAAGCACTTACTGAGTGGGAATACCTGCCACCCGTTGGACCCCGTCCACCAAAAGGATTTGTGGGGCT

GAAAAATGCTGGTGCTACTTGTTACATGAACTCTGTGATCCAGCAACTCTATATGATCCCCTCTATCAGGAATGGTATTCTTGCCATAGAAGGCACAGGT

AGTGATGTAGATGATGATATGTCTGGGGATGAGAAGCAGGACAACGAG AGCAATGTTGATCCCAGGGATGATGTGTTTGGATATCCTCAACAATTTGAA

GACAAACCACCACTGAGTAAAACAGAAGATAGGAAAGAGTACAATATTGGTGTTCTAAGACACCTTCAGGTTATCTTTGGCCATTTAGCTGCTTCTCGAC

TACAGTACTATGTGCCTAGAGGATTTTGGAAACAGTTCAG GCTTTGGGGTGAGCCTGTCAATCTTCGTGAACAACATGATGCTTTAGAGTTCTTTAATT

CTTTGGTGGATAGTTTAGATGAAGCTTTAAAAGCCTTAGGGCATCCAGCTATGCTAAGTAAAGTCTTGGGAGGTTCCTTTGCTGATCAGAAAATTTGCCA

AGGCTGCCCACATAG - UNI10485 - GTACGAATGTGAAGAATCTTTTACGACTCTGAATGTAGACATTAGAAACCACCAAAATCTTCTGGATTCTT

TGGAACAGTATGTCAAAGGAGACTTACTAGAAGGAGCAAATGCTTATCATTGTGAAAAATGCAATAAAAAG GTTGATACTGTAAAGCGCTTGCTAATTA

AAAAATTGCCTCCTGTTCTTGCTATCCAACTAAAACGATTCGATTATGACTGGGAAAGAGAATGTGCAATCAAGTTCAATGATTACTTTGAATTTCCTCG

AGAGTTAGACATGGAACCTTACACAGTGGCAGGTGTTGCTAAACTGGAGGGAGATAATGTCAACCCAGAAAGTCAGCTGATACAACAGAATGAGCAGTCT

GAAAGCGAGAAAGCAGGAAGCACAAAATACAGACTTGTGGGTGTGCTTGTGCACAGTGGTCAAGCAAGTGGCGGACATTACTATTCTTACATCATTCAGA

GGAATGGAGGGGATGGTGAAAAAAATCGTTGGTATAAATTTGATGATGGAGATGTAACGGAATGTAAAATGGATGACGATGAAGAAATGAAAAACCAGTG

TTTTGGGGGAGAGTACATGGGAGAAGTATTTGATCACATGATGAAGCGCATGTCGTACAGGCGTCAGAAAAGATGGTGGAATGCATATATACTTTTTTAT

GAACGAATGGACACAATAGGTCATGATGATGAGGTGATAAGATACATATCAGAGATTGCTATCACCACAAGGCCCCATCAGATTGTCATGCCATCCGCCA

TTGAAAGAAGTGTTCGGAAGCAGAATGTTCAGTTCATGCACAACCGAATGCAGTACAGTCTGGAATATTTTCAGTTTATGAAAAAGCTACTGACATGTAA

TGGTGTTTACTTAAACCCTCCTCCAG - UNI12284 - GGCAAGATCACCTGTCTCCTGAAGCAGAAGAAATCACTATGATTAGTATTCAGCTTGCTG

CTAGGTTCCTTTTTACTACAGGATTTCACACAAAGAAAATAGTCCGAGGATCTGCCAGTGATTG - UNI11535 - GTATGATGCATTGTGTATTCTC

CTGCGTCACAGCAAGAACGTGCGGTTTTGGTTTGCTCACAATGTCCTTTTTAATGTTTCAAATCGATTCTCTGAGTACCTTTTGGAATGCCCTAGTGCAG

AAGTGAGAGGTGCATTTGCAAAGCTCATAGTTTTCATTGCACATTTTTCCTTACAAGACGGGCCTTGTCCTTCACCTTTTGCATCTCCTGGACCTTCTAG

TCAG - UNI29142 - GCTTATGACAACTTAAGTTTGAGTGACCACTTACTAAGAGCAGTACTAAATCTCTTGCGGAGGGAGGTTTCAGAGCATGGAC

GTCATTTACAGCAGTATTTCAACTTGTTCGTAATGTATGCCAATTTAG - UNI1648 - GAGTGGCAGAGAAAACACAGCTGCTCAAACTGAGTGTAC

CTGCTACCTTTATGCTTGTGTCCTTAGATGAAGGTCCTGGCCCTCCAATTAAATATCAGTATGCTGAATTAGGCAAATTATACTCAGTAGTGTCACAGCT

CATCCGCTGTTGCAATGTCTCTTCAAGAATGCAGTCTTCGATCAATG - UNI20507 - GTAATCCTTCTCTTCCAAATCCTTTTGGTGATCCTAACT

TATCACAACCTATAATGCCAATTCAACAAAATGTGGTAGACATTTTATTTGTGAGAACAAGTTATGTGAAGAAAATTATTGAAGACTGCAGTAACTCTGA

TGAGACCGTCAAATTGCTTCGCTTTTGCTGCTGGGAGAATCCTCAGTTCTCATCTACTGTCCTCAGTGAACTTCTTTGGCAG GTTGCATATTCTTATAC

TTATGAACTCCGGCCCTATTTGGATCTGCTTTTACAAATCTTACTGATTGAAGACTCTTGGCAGACTCACAG - UNI12320 - AATTCATAATGCCC

TTAAAGGAATTCCAGATGACCGAGATGGGCTGTTTGACACAATTCAGCGTTCTAAGAATCACTATCAAAAAAGAGCATACCAGTGTATAAAATGTATGGT

AGCCCTCTTTAGCAGTTGTCCTGTTGCTTACCAAATCCTGCAG GGCAATGGAGATCTTAAAAGGAAATGGACCTGGGCAGTGGAGTGGCTTGGAGATGA

ACTTGAAAGAAGACCATACACTGGCAATCCTCAGTACACTTACAACAATTGGTCTCCTCCAGTGCAAAGCAATGAAACATCAAATGGTTATTTCTTAGAG

AGATCACACAGCGCTAGGATGACACTTGCAAAAGCTTGTGAACTCTGTCCTGAGGAG - UNI2587 - GAACCAGATGACCAAGATGCCCCAGATGAG

CATGAATCACCTCCACCAGAAGATGCTCCTTTATACCCTCATTCCCCTGGATCTCAATATCAGCAG - UNI7489 - - UNI16375 - AATAACCA

TGTGCATGGACAGCCATATACAGGCCCAGCAGCACATCACATGAACAACCCTCAGAGAACTGGCCAACGAGCACAAGAAAATTATGAAGGCGGTGAAGAA

GTGTCCCCTCCTCAGACCAAGGATCAGTGAAATGCACATATTAACTGGTTCCATCAAGACTGTGCACCCAGGCCTTACAGTCCAACTTTTTTCTGTGTCT

GGCTAATATTTCAAACTAGAAAAACTATTCCTAATCAACATGGAGTGGAGAGTTTATTCATTGTCTTATCTGCAGAAATTTGCTGTCAATATATAACCCG

CCTGCAGTGGAAAGTGTATAGTGTTTTGTAATAAATGGCCTGATGCTAATGTGTAAATGGCAAAGGTGTATATAGTATATTAATGTTTGACTGTTAATTC

TTAAGCAAGAATTTTTTTTTCTTCATGAGACTCACAGATCTACAAAACTACATTAATTTTCTTGTTATACCTACTGCTCTCTGCAGCCAGTGTTGCCTAC

CTTGTGGCAGTTGGATCACCTCCTTTACAAAAACAAAAAGTAAATCAACATCAACAAAACAGCCCATTCATTCATGTCACACCAATAGTTTCCTGTTCAT

TGTTTGCCACTTGGAGTCAATTTTACTATGAGCAATGTAAGGCTGATTACCTTTGATTTATTTGATTGATGTGGAAAATTGGTGATGTACTATGTTTCTA

GTCTTTCTCATTGCCTTTTTATTCTGATGTTAGGTTAATCACTTTGAAGCTATAGATATGCTGTAACATTTAGCATGGCTTCACACAAGTTAGTGTAGCC

AGTGAAGAAATATTACCATAATGACTGCAGTTGTCCTGACATGACACCTGCATTGCTCGGAGCTTTCCTTCTTAAACCCTAGATTATAAAATACAGACTG

AGGGAGAACTGTGGCAAGGAAGCGGTTCTCAGTTACACGCGTGTTCTTCTCATGTTTGACAGTGTGATCTCTGGGTAGAATAAAGAACACTTAAACTTAT

CGACTTGGTAATGGGAATTTTGAAAGATTTAAAACAAATACACAAAAATTTGCTATGCCAGTATGCTGGCTGGAGCCTAGTAGACTGTATTTGATGTGCT

TGTTTCGTTCTTTGCTAGAGCTTACTAAGTGACTCTTTTTCAAACTGTCCTTCCTTCTGCTGGATCCCAGTGCTGTGGAAGTCCTCAGAATCCCACAGTC

TTTGGAGTACCTCTGCACCAAGGTCTCTGGCTGATTCTCTGCTCAGTCATAATTTTACTTGAAAGCAAAAATTGTCCAAGCTCCTTTTCCATTCCAAAAA

TTTTAACATTCAAAGCAGGGTCTAATTTAAGAAATTACTGGTAGTTAATACAATTAAGGAATTAAATTTTAGAATAAACAATTTGAATAAAGATAAAGGA

ATCAGTTAAAGCTGTGTTTCAAAGAAAATTGGTGATTTGAATATGTGTAATTTTTTTGGAACCTGTCTAAAACCAAATACCCCTGCAAACAGATAAAACC

TACCCTATTTAAATATTTTGCTGTTTTATTTTATAGAAATTATTTTGCTGAATTTGCAAATAGAATTTGATTTAAGAAGAACTTTTTGTCCTGTGGTATG

TTTGGGGGTTTTGATAACCTTCTCTGTCTGCCTGTCTCTCTTTTTTTGAGGACTGCATATTTCTGGAAAGCTGATTTCTATGCATAGCATGTGTAGACAT

AACCAGCAATGAAGATTTTAGTCTCATTAAGTTTTTGTGCACAGAAAGATGGGGGTCTTTGGCTCTTTACTAAAGACTTGGAGAACCGGATGTTGATGCT

GTAAAAGTTCCCTAACAATCAATCTTGTACTTTTTGTATGTTTTTATATACATGTGTATTTAATGAGCACAAGCTTGGTTGTATTTTTTACGATTCAGTT

GATAGGAAAATGTTTTAAGGCTATAGTTGGCATTGATCAAAGCAGAAGCAAAATTGAGCATTGTTATTTTGTGATTTAAAAGGGGCAGTATTTAAGATAA

AGGTTTAGGTATCTTATTTGCAGTATTCCACAGTTCTGCTTCTAGACTTCCTGTAATTTTAGCGACCTTTGACAGCAGATTCTGTTTACATCAGAATTTG

CTTTTGTTTCGGTTTTTTGGAGCCTGGGGATCCAGAACCTGAAGTACTCCAGGCGAGCGCTCTACCATTGAGCTGCGCCTCCAGCCTGAATTGAAGTTTG

AGCAAAGTACAGTGTTTGCAACTCCAACTGGAAGTTTTTTAAAGTTCTTCAAGTAGTAAAGTAGGTTAGCTTTGTTTGGATGAGTAACTGGTACTAGTTA

TGTTATCTTACCATCTGACATGCGACTTTGGTATTTTCTGCTTCTTAAGGAAATTATGAAATATGTAAAACTTAGTGACTTCCTAGGTAAGAAGAAAACT

TGACATTTTCAAAGGCTGTGAATTTTTCTTGGAGGGATTCTACCCCCGGCCCCCAGTAGTTGCTTTAAGTGTATAAGCCCACCAGTTCCAGATGATAGGG

GATTATGGAGTCATGGTTCCCCTCATTTGAGGAAGAGTGGGCCTGTGTTGTGACCAGGAGTGAGGGAAGGTGAACAGAGTTATTTTTGTTTGTTTGTGCA

AATTATTTTCTATATTAACTCTTTAAGCATTAATGTATAACCGGAAATTTTAAGATGCATGTTATTGTAAGCGCAACATAGTGGTGATTTTGAGGTCTTT

CTCTAAAACATAAGTGGCACATTTTAAATTTCAAGTCTTAAAGTGCCTGAAAGTTATTTGATTCTCTCAACTAATTTCTTTTGAGCCATATGTTTCCTCC

TTTAAATGTTTGTTGCAGAATCACTAGTCTTCGTTTGAAGTACTCCCACATTTCTAAATGGCATGATTGCTCTATTGAAGACAGTAGAATCTGTTAACGT

AAGACTGAAGAGATTTTATTGTGCAACTGTGTAAACTGGGGCTTTGCCCAGTCGGATCTAAGTATTTTTGTGTACAACTTGGTAAACACCATATTGCTGC

TGTTTCTAAACCCTCCACCTACCGAATTCTCATGTTCAGCATCGCAGAGGCAGAAATACAAGCATAATCATATATGGGCTTTGTTTCTTTTCATTGATTT

TTCTTAGTGATGATTTCCCAGCCTTTTTTTTTTTTTTTGTCTCTTAGCTATAATTATACAGACCTAGAATTATTCAAATGTTTTCTATTTTCATGATTAA

CTTTTATTAGTGGACAATAACAACTTAAGTCTTTAATCCTCATATTGGTTAAAAACATGAGGAGCCTTTTTTATTTGAATTACTTTTGTAAAAGAAAGCA

ACAGTCTGAATATTCAGGTGACTACTTTGGCATAGTTCGGGTTTTTATTAGTATTTTTCCAGGTTATGTTTTCCCATGAACTATTTTACTTTGTTAATTT

TGTGCTTAATTTGGTGGCTATATCCTGCCTTATTTAGAATTTTAGAAAATTGCCTTTTTGCGATAAGTGCCCAGTTTTTATTTCTAGTTTGAAGGTACGA

GGACATACAGACTGCTGATAAAAGAAACCAGCACCCCTTTGCCCCAGCTTATGTGTTACCAACAAAACCATTCTCAGTACTGGTTTCATTGTAGGGCCCA

ACCAGAATTGGTCCTGCATCTACATGAGTGTTGCATATTTGAAAAGGGTTTGGGTGTGATAAATCACTACAGAAGTGCTGAATGTATTAAGACCTCGCTG

CCGATTGTATTTCTAACGATTATTTTGTGTTTGCAGAAGTATGTAGCACTTGTCCTCCAAGCTTTCAGGTGTAAGGGGGAAAGGTGAACCACATTTTAAA

GTCACTAATGAGTGCAATTTTTTTTTTTTTTGGAATTGGGGTTCCCAAAAGGAAATTTCACCGCCCAAATCTCACATACTTCTTAGCCTTTTACAAGCCA

ACAGATTGACATAAAGATTGTCCGCAGTTCGTAAGATCTAGCACATATACAAAAATAAAACTTTATAAATTAAA
Translation
 - UNI15532 - MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQ - UNI27370 - TSSPDSSNENSPATPPDEQGQGDAPPQIEDEEPAFPHTDL

AKLDDMINR - UNI26032 - RPRWVVPVLPKGELEVLLEAAIDLSKKG - UNI23994 - GLDVKSEACQRFFRDGLTISFTKILTDEAVSGWKF

EIH - UNI20398 - RCIINNTHRLVELCVAKLAQDWFPLLELLAMALNPHCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPK GWLVDLLNK

FGTLNGFQILHDRFINGSALNVQIIAALIK KPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRVPGQE

ETVKNLEIFRLKMILR RLLQISSFNGKMNALNEVNKVISSVSYYTHRHGSSEDEEWLTAERMA - UNI2 - EWIQQNNILSIVLRDSLHQPQYVEKL

EKILRFVIKEKALTLQDLDNIWAAQ AGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFK ASWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLL

WNLAHSDDVPVDIMDLALSAHIKILDYSCSQ - UNI1775 - DRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLS SQSQRSPHV

FYRHDLINQLQHNHALVTLVAENLATYMESMRMYGRD - UNI12342 - DNEDYDPQTVRLGSRYSHVQEVQERLNFLR - UNI35406 - RFLLK

DGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDL

ELIGLDYLWR - UNI3658 - VVIQSNDDIACRAIDLLKEIYTNLGPRLQVNQ VVIHEDFIQSCFDRLKASYDTLCVLDGDKDSINCARQEAVRMVR

VLTVLREYINECDSDYHEERTILPMSR - UNI10938 - RAFRGKHLSFIVRFPNQGRQVDDLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVG

GELIDPGDDRKLIGQLNLKDKS LITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGV - UNI27599 - IMSLHPRYISFLW

QVADLGSSLNMPPLRDGARVLMKLMPPD - UNI15389 - DSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQVLYLTE VVYALLMPAGAPL

TDDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTS - UNI352 - VNQVTHDQ

AVVLQSALQSIPNPSSECMLRNVSVRLAQQISDE ASRYMPDICVIRAIQKIIWTSGCGGLQLVFSPNEEVTKIYEK - UNI12236 - TNAGNEPDL

EDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSK - UNI18666 - KTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLG S

TARERAKHSGDYFTLLRHLLNYAYNSNINVPNAEVLLNNEIDWLKRIR DDVKRTGETGVEETILEGHLGVTKELLAFQTPEKKFHIGCEKGGANLIK E

LIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINAGFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITT TCEALTEWEYLPPVGPRPPKGFVGL

KNAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNE SNVDPRDDVFGYPQQFEDKPPLSKTEDRKEYNIGVLRHLQVIFGHLAASR

LQYYVPRGFWKQFR RLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHR - UNI10485 - RYECEESFTTLN

VDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKK VDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNV

NPESQLIQQNEQSESEKAGSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYR

RQKRWWNAYILFYERMDTIGHDDEVIRYISEIAITTRPHQIVMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPG - UNI12284

 - GQDHLSPEAEEITMISIQLAARFLFTTGFHTKKIVRGSASDW - UNI11535 - WYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSA

EVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQ - UNI29142 - AYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLFVMYANLG - UNI1

648 - GVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVSSRMQSSING - UNI20507 - GNPSLPNPFGDPNLSQP

IMPIQQNVVDILFVRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSSTVLSELLWQ VAYSYTYELRPYLDLLLQILLIEDSWQTHR - UNI12320 

- RIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAYQILQ GNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNE

TSNGYFLERSHSARMTLAKACELCPEE - UNI2587 - EPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQ - UNI7489 - - UNI16375 - NN

HVHGQPYTGPAAHHMNNPQRTGQRAQENYEGGEEVSPPQTKDQ
Transcript ENSMUST00000115466
Sequence
AGTGGGAGTCTGCGCTGCCGCTGCTGTTGCTGCCGCCGTCGCCGCCGCCTCCGACACTGCCACCGCCACCGCCACCACCACCGGCCGTGCGGGTTTTCTT

TCTTTTTCTTTCTGTCTTTTCTTTTCTTTCTTGATTTGTTGGGTTCGCCATATTGACGAGGCTGTGGTACCCAAGGCTGCGGAAGCTAGAGTCCGCCGGT

GGCGGAGCCGCAAGCTCTCG - UNI15532 - GTTATGCAATGGTCTCTGCAAGATGTTTTATTCTTGAATTGGAACCTTTTACGACTGACAAATGCT

GGTACTTTATCTCCTATAAGTGGACTATAATTTCTTTTCTTAAGACAACTACATAAGCAGACAAAATTGCAAAGATCTGCCCTGTGTCGAGTATGACAGC

CACGACTCGTGGCTCTCCAGTTGGAGGGAATGACAACCAGGGCCAAGCCCCTGATGGACAGTCTCAGCCCCCCCTCCAACAGAATCAG - UNI27370 

- ACTTCATCGCCTGATTCGTCCAATGAAAATTCCCCTGCAACTCCTCCTGATGAGCAAGGTCAAGGTGATGCTCCTCCACAGATTGAAGATGAGGAACC

TGCATTTCCACACACTGACTTGGCAAAGTTAGATGATATGATCAACAG - UNI26032 - GCCTCGATGGGTTGTTCCAGTTTTGCCGAAAGGGGAAT

TAGAAGTGCTTTTAGAAGCTGCTATTGATCTTAGTAAGAAAG - UNI23994 - GCCTTGATGTTAAAAGTGAAGCATGTCAGCGATTTTTCCGAGAT

GGGCTAACGATCTCATTTACAAAAATCCTGACAGATGAAGCAGTGAGTGGCTGGAAGTTTGAAATTCAC - UNI20398 - AGATGCATTATTAACAA

TACTCATCGCCTGGTGGAGCTATGTGTGGCTAAGTTAGCCCAAGACTGGTTTCCACTTCTAGAACTTCTTGCCATGGCCTTAAATCCTCATTGCAAATTC

CATATCTACAATGGTACACGTCCCTGCGAGTCAGTGTCCTCAAGTGTTCAGTTGCCTGAAGATGAACTCTTTGCTCGTTCTCCAGACCCTCGATCACCAA

AA GGTTGGCTAGTGGATCTCCTCAACAAGTTTGGCACTTTAAATGGATTCCAGATACTGCACGATCGTTTTATTAATGGATCAGCATTAAACGTTCAGA

TAATTGCAGCCCTTATTAA ACCATTTGGACAGTGCTATGAGTTTCTTACTCTTCACACAGTGAAAAAGTACTTTCTTCCAATAATAGAAATGGTTCCAC

AGTTTTTAGAAAACTTAACTGATGAAGAGCTGAAGAAAGAAGCAAAGAATGAAGCCAAAAATGATGCTCTTTCAATGATTATTAAATCATTGAAGAATTT

AGCTTCGCGGGTTCCTGGACAAGAAGAAACTGTAAAAAACTTAGAAATATTTAGGTTAAAAATGATACTTAG ATTGTTGCAAATTTCTTCTTTCAATGG

AAAGATGAATGCACTGAATGAGGTTAATAAGGTGATTTCCAGTGTGTCATACTATACCCATCGGCATGGCAGTTCTGAGGATGAAGAGTGGCTTACAGCA

GAGAGGATGGCT - UNI2 - GAATGGATACAGCAGAACAATATTTTATCCATAGTTTTACGAGATAGCCTTCATCAACCACAGTATGTAGAGAAACTA

GAAAAGATTCTTCGCTTTGTCATAAAAGAAAAAGCTCTGACCTTGCAAGATCTTGATAATATCTGGGCAGCACAG GCAGGGAAACATGAAGCCATTGTA

AAGAATGTACATGATCTACTGGCCAAATTGGCATGGGATTTTTCTCCTGAACAACTTGATCATCTTTTTGATTGCTTTAAG GCCAGTTGGACAAATGCA

AGTAAAAAGCAACGTGAAAAGCTCCTTGAGCTGATTCGTCGTCTTGCAGAAGATGATAAAGATGGTGTGATGGCACATAAAGTATTGAACCTTCTGTGGA

ATCTAGCTCACAGTGATGATGTGCCTGTAGATATCATGGATTTGGCTCTCAGTGCTCACATCAAAATACTAGATTATAGTTGCTCCCAG - UNI1775 

- GACCGGGACACCCAAAAGATCCAGTGGATTGATCGCTTCATAGAAGAACTTCGCACAAATGACAAATGGGTCATTCCTGCACTGAAACAAATTAGAGA

AATTTGTAGTTTGTTTGGTGAAGCACCTCAAAATTTGAG TCAAAGTCAGCGAAGTCCCCATGTATTTTATCGCCATGACTTAATCAATCAACTTCAGCA

CAATCATGCCCTAGTTACTTTGGTAGCAGAAAACCTTGCAACTTACATGGAAAGCATGAGAATGTATGGCAGAG - UNI12342 - ACAATGAAGACT

ATGACCCACAAACTGTGAGACTGGGAAGTAGATATAGTCATGTTCAAGAAGTCCAAGAACGGCTTAACTTTCTTAG - UNI35406 - GTTTTTATTG

AAGGATGGCCAGCTGTGGCTGTGTGCTCCACAGGCAAAACAAATATGGAAGTGCTTAGCAGAGAATGCGGTTTATCTTTGTGATCGTGAAGCCTGTTTTA

AGTGGTATTCCAAATTAATGGGAGACGAACCTGACTTAGATCCTGATATCAATAAGGACTTCTTTGAAAGTAATGTGCTTCAGCTTGATCCTTCCCTGTT

AACTGAAAATGGGATGAAGTGTTTTGAGAGATTCTTCAAAGCTGTGAATTGTCGAGAAGGAAAACTAGTAGCAAAAAGAAGAGCCTACATGATGGATGAT

TTGGAATTGATAGGATTAGACTATCTTTGGAGA - UNI3658 - GTTGTAATTCAGAGTAATGATGATATTGCCTGCCGAGCTATTGATCTCCTTAAA

GAGATATACACAAACCTTGGTCCAAGGCTGCAGGTCAATCAG GTGGTGATCCATGAAGACTTCATTCAGTCTTGCTTTGATCGTTTGAAAGCCTCTTAT

GACACATTGTGTGTTTTGGATGGTGACAAAGACAGTATTAATTGTGCAAGACAGGAAGCTGTTCGAATGGTCCGAGTGTTAACTGTTCTAAGAGAATATA

TAAATGAATGTGACAGTGATTATCATGAAGAAAGAACAATTTTGCCTATGTCAAG - UNI10938 - AGCTTTCCGTGGTAAACACCTCTCTTTTATA

GTTCGATTTCCAAACCAGGGCAGGCAAGTAGATGACTTGGAGGTTTGGTCTCATACAAATGATACCATTGGTTCAGTTCGAAGATGTATACTCAATCGTA

TTAAAGCCAATGTAGCTCATACAAAAATTGAACTCTTTGTGGGTGGTGAGCTTATTGATCCTGGAGATGACCGAAAGTTGATTGGACAATTAAACCTAAA

AGATAAATCA CTAATTACAGCCAAACTTACACAAATAAGCTCCAATATGCCTTCAAGTCCTGATAGCTCCTCTGATTCCTCAACTGGATCTCCTGGAAA

TCATGGTAATCATTACAGTGATGGCCCCAATCCAGAAGTGGAAAGTTGTTTGCCTGGAGTG - UNI27599 - ATAATGTCACTTCATCCCAGATACA

TCTCTTTCCTTTGGCAAGTTGCAGACTTAGGGAGCAGCCTAAATATGCCACCTCTTAGAGATGGAGCAAGAGTGCTTATGAAACTTATGCCGCCAG - U

NI15389 - ATAGTACGACAATAGAAAAGTTAAGAGCTATTTGTTTGGACCATGCCAAACTTGGAGAAAGCAGCCTTAGTCCATCTCTTGACTCACTTT

TCTTTGGTCCTTCAGCCTCACAAGTGCTATACCTAACAGAG GTAGTCTATGCCTTGTTAATGCCCGCTGGTGCACCCTTGACTGATGATTCCTCGGATT

TTCAGTTTCACTTCTTGAAAAGTGGTGGTCTGCCCCTTGTCCTGAGTATGCTAACCAGAAATAACTTCCTACCAAATGCAGATATGGAAACTCGAAGGGG

TGCCTACCTCAATGCTCTTAAAATAGCCAAACTGTTACTAACTGCCATTGGCTATGGCCATGTTCGTGCTGTGGCAGAAGCTTGTCAACCAGGTGTAGAA

GGCGTGAATCCTATGACATCG - UNI352 - GTCAACCAAGTAACTCATGATCAAGCAGTGGTGCTACAAAGTGCCCTTCAGAGCATTCCTAACCCAT

CATCTGAATGCATGCTTAGAAACGTGTCTGTTCGCCTTGCTCAGCAGATTTCTGATGAG GCTTCAAGATATATGCCTGATATTTGTGTAATTAGAGCTA

TACAAAAAATTATTTGGACATCAGGATGTGGAGGATTACAGCTGGTATTCAGCCCAAATGAAGAAGTGACAAAAATTTATGAGAAG - UNI12236 - 

ACCAATGCAGGCAATGAGCCAGACCTCGAAGATGAACAGGTTTGCTGTGAAGCATTGGAGGTGATGACACTGTGTTTCGCCTTGATTCCAACAGCCTTAG

ATGCTCTAAGTAAAGAAAAAGCTTGGCAGACATTTATTATTGACTTACTGTTGCACTGTCACAGCAA - UNI18666 - AACTGTTCGTCAAGTGGCA

CAGGAACAATTCTTCTTAATGTGCACCAGATGTTGCATGGGGCACAGGCCTCTACTTTTCTTCATTACGCTGCTCTTTACTGTTTTGGGG AGCACAGCC

AGAGAGAGGGCTAAACACTCAGGCGACTACTTTACTCTTTTAAGACATCTTCTTAATTACGCCTACAACAGTAACATTAATGTGCCCAATGCTGAAGTTC

TTCTAAATAATGAAATTGATTGGCTTAAAAGAATTAGG GATGATGTTAAAAGGACAGGTGAAACAGGTGTTGAGGAGACAATCTTAGAAGGACACCTTG

GGGTTACAAAGGAGCTACTGGCTTTTCAGACTCCTGAGAAAAAGTTTCATATTGGTTGTGAAAAGGGAGGTGCTAATCTCATTAAA GAATTAATCGACG

ACTTCATCTTTCCCGCATCCAATGTTTACCTGCAGTATATGAGAAATGGAGAACTCCCTGCTGAGCAGGCCATTCCTGTGTGTGGTTCACCAGCCACAAT

TAATGCTGGTTTTGAGTTACTTGTGGCATTAGCTGTTGGCTGTGTGAGGAACCTCAAACAGATAGTAGATTCTTTGACTGAAATGTATTACATTGGTACA

GCAATAACTA CTTGTGAAGCACTTACTGAGTGGGAATACCTGCCACCCGTTGGACCCCGTCCACCAAAAGGATTTGTGGGGCTGAAAAATGCTGGTGCT

ACTTGTTACATGAACTCTGTGATCCAGCAACTCTATATGATCCCCTCTATCAGGAATGGTATTCTTGCCATAGAAGGCACAGGTAGTGATGTAGATGATG

ATATGTCTGGGGATGAGAAGCAGGACAACGAG AGCAATGTTGATCCCAGGGATGATGTGTTTGGATATCCTCAACAATTTGAAGACAAACCACCACTGA

GTAAAACAGAAGATAGGAAAGAGTACAATATTGGTGTTCTAAGACACCTTCAGGTTATCTTTGGCCATTTAGCTGCTTCTCGACTACAGTACTATGTGCC

TAGAGGATTTTGGAAACAGTTCAG GCTTTGGGGTGAGCCTGTCAATCTTCGTGAACAACATGATGCTTTAGAGTTCTTTAATTCTTTGGTGGATAGTTT

AGATGAAGCTTTAAAAGCCTTAGGGCATCCAGCTATGCTAAGTAAAGTCTTGGGAGGTTCCTTTGCTGATCAGAAAATTTGCCAAGGCTGCCCACATAG 

- UNI10485 - GTACGAATGTGAAGAATCTTTTACGACTCTGAATGTAGACATTAGAAACCACCAAAATCTTCTGGATTCTTTGGAACAGTATGTCAA

AGGAGACTTACTAGAAGGAGCAAATGCTTATCATTGTGAAAAATGCAATAAAAAG GTTGATACTGTAAAGCGCTTGCTAATTAAAAAATTGCCTCCTGT

TCTTGCTATCCAACTAAAACGATTCGATTATGACTGGGAAAGAGAATGTGCAATCAAGTTCAATGATTACTTTGAATTTCCTCGAGAGTTAGACATGGAA

CCTTACACAGTGGCAGGTGTTGCTAAACTGGAGGGAGATAATGTCAACCCAGAAAGTCAGCTGATACAACAGAATGAGCAGTCTGAAAGCGAGAAAGCAG

GAAGCACAAAATACAGACTTGTGGGTGTGCTTGTGCACAGTGGTCAAGCAAGTGGCGGACATTACTATTCTTACATCATTCAGAGGAATGGAGGGGATGG

TGAAAAAAATCGTTGGTATAAATTTGATGATGGAGATGTAACGGAATGTAAAATGGATGACGATGAAGAAATGAAAAACCAGTGTTTTGGGGGAGAGTAC

ATGGGAGAAGTATTTGATCACATGATGAAGCGCATGTCGTACAGGCGTCAGAAAAGATGGTGGAATGCATATATACTTTTTTATGAACGAATGGACACAA

TAGGTCATGATGATGAGGTGATAAGATACATATCAGAGATTGCTATCACCACAAGGCCCCATCAGATTGTCATGCCATCCGCCATTGAAAGAAGTGTTCG

GAAGCAGAATGTTCAGTTCATGCACAACCGAATGCAGTACAGTCTGGAATATTTTCAGTTTATGAAAAAGCTACTGACATGTAATGGTGTTTACTTAAAC

CCTCCTCCAG - UNI12284 - GGCAAGATCACCTGTCTCCTGAAGCAGAAGAAATCACTATGATTAGTATTCAGCTTGCTGCTAGGTTCCTTTTTAC

TACAGGATTTCACACAAAGAAAATAGTCCGAGGATCTGCCAGTGATTG - UNI11535 - GTATGATGCATTGTGTATTCTCCTGCGTCACAGCAAGA

ACGTGCGGTTTTGGTTTGCTCACAATGTCCTTTTTAATGTTTCAAATCGATTCTCTGAGTACCTTTTGGAATGCCCTAGTGCAGAAGTGAGAGGTGCATT

TGCAAAGCTCATAGTTTTCATTGCACATTTTTCCTTACAAGACGGGCCTTGTCCTTCACCTTTTGCATCTCCTGGACCTTCTAGTCAG - UNI29142 

- GCTTATGACAACTTAAGTTTGAGTGACCACTTACTAAGAGCAGTACTAAATCTCTTGCGGAGGGAGGTTTCAGAGCATGGACGTCATTTACAGCAGTA

TTTCAACTTGTTCGTAATGTATGCCAATTTAG - UNI1648 - GAGTGGCAGAGAAAACACAGCTGCTCAAACTGAGTGTACCTGCTACCTTTATGCT

TGTGTCCTTAGATGAAGGTCCTGGCCCTCCAATTAAATATCAGTATGCTGAATTAGGCAAATTATACTCAGTAGTGTCACAGCTCATCCGCTGTTGCAAT

GTCTCTTCAAGAATGCAGTCTTCGATCAATG - UNI20507 - GTAATCCTTCTCTTCCAAATCCTTTTGGTGATCCTAACTTATCACAACCTATAAT

GCCAATTCAACAAAATGTGGTAGACATTTTATTTGTGAGAACAAGTTATGTGAAGAAAATTATTGAAGACTGCAGTAACTCTGATGAGACCGTCAAATTG

CTTCGCTTTTGCTGCTGGGAGAATCCTCAGTTCTCATCTACTGTCCTCAGTGAACTTCTTTGGCAG GTTGCATATTCTTATACTTATGAACTCCGGCCC

TATTTGGATCTGCTTTTACAAATCTTACTGATTGAAGACTCTTGGCAGACTCACAG - UNI12320 - AATTCATAATGCCCTTAAAGGAATTCCAGA

TGACCGAGATGGGCTGTTTGACACAATTCAGCGTTCTAAGAATCACTATCAAAAAAGAGCATACCAGTGTATAAAATGTATGGTAGCCCTCTTTAGCAGT

TGTCCTGTTGCTTACCAAATCCTGCAG GGCAATGGAGATCTTAAAAGGAAATGGACCTGGGCAGTGGAGTGGCTTGGAGATGAACTTGAAAGAAGACCA

TACACTGGCAATCCTCAGTACACTTACAACAATTGGTCTCCTCCAGTGCAAAGCAATGAAACATCAAATGGTTATTTCTTAGAGAGATCACACAGCGCTA

GGATGACACTTGCAAAAGCTTGTGAACTCTGTCCTGAGGAG - UNI2587 - GAACCAGATGACCAAGATGCCCCAGATGAGCATGAATCACCTCCAC

CAGAAGATGCTCCTTTATACCCTCATTCCCCTGGATCTCAATATCAGCAG - UNI7489 - - UNI16375 - AATAACCATGTGCATGGACAGCCA

TATACAGGCCCAGCAGCACATCACATGAACAACCCTCAGAGAACTGGCCAACGAGCACAAGAAAATTATGAAGGCGGTGAAGAAGTGTCCCCTCCTCAGA

CC - UNI16375 - - UNI34406 - GGATCAGTGAAATGCACATATTAACTGGTTCCATCAAGACTGTGCACCCAGGCCTTACAGTCCAACTTTTT

TCTGTGTCTGGCTAATATTTCAAACTAGAAAAACTATTCCTAATCAACATGGAGTGGAGAGTTTATTCATTGTCTTATCTGCAGAAATTTGCTGTCAATA

TATAACCCGCCTGCAGTGGAAAGTGTATAGTGTTTTGTAATAAATGGCCTGATGCTAATGTGTAAATGGCAAAGGTGTATATAGTATATTAATGTTTGAC

TGTTAATTCTTAAGCAAGAATTTTTTTTTCTTCATGAGACTCACAGATCTACAAAACTACATTAATTTTCTTGTTATACCTACTGCTCTCTGCAGCCAGT

GTTGCCTACCTTGTGGCAGTTGGATCACCTCCTTTACAAAAACAAAAAGTAAATCAACATCAACAAAACAGCCCATTCATTCATGTCACACCAATAGTTT

CCTGTTCATTGTTTGCCACTTGGAGTCAATTTTACTATGAGCAATGTAAGGCTGATTACCTTTGATTTATTTGATTGATGTGGAAAATTGGTGATGTACT

ATGTTTCTAGTCTTTCTCATTGCCTTTTTATTCTGATGTTAGGTTAATCACTTTGAAGCTATAGATATGCTGTAACATTTAGCATGGCTTCACACAAGTT

AGTGTAGCCAGTGAAGAAATATTACCATAATGACTGCAGTTGTCCTGACATGACACCTGCATTGCTCGGAGCTTTCCTTCTTAAACCCTAGATTATAAAA

TACAGACTGAGGGAGAACTGTGGCAAGGAAGCGGTTCTCAGTTACACGCGTGTTCTTCTCATGTTTGACAGTGTGATCTCTGGGTAGAATAAAGAACACT

TAAACTTATCGACTTGGTAATGGGAATTTTGAAAGATTTAAAACAAATACACAAAAATTTGCTATGCCAGTATGCTGGCTGGAGCCTAGTAGACTGTATT

TGATGTGCTTGTTTCGTTCTTTGCTAGAGCTTACTAAGTGACTCTTTTTCAAACTGTCCTTCCTTCTGCTGGATCCCAGTGCTGTGGAAGTCCTCAGAAT

CCCACAGTCTTTGGAGTACCTCTGCACCAAGGTCTCTGGCTGATTCTCTGCTCAGTCATAATTTTACTTGAAAGCAAAAATTGTCCAAGCTCCTTTTCCA

TTCCAAAAATTTTAACATTCAAAGCAGGGTCTAATTTAAGAAATTACTGGTAGTTAATACAATTAAGGAATTAAATTTTAGAATAAACAATTTGAATAAA

GATAAAGGAATCAGTTAAAGCTGTGTTTCAAAGAAAATTGGTGATTTGAATATGTGTAATTTTTTTGGAACCTGTCTAAAACCAAATACCCCTGCAAACA

GATAAAACCTACCCTATTTAAATATTTTGCTGTTTTATTTTATAGAAATTATTTTGCTGAATTTGCAAATAGAATTTGATTTAAGAAGAACTTTTTGTCC

TGTGGTATGTTTGGGGGTTTTGATAACCTTCTCTGTCTGCCTGTCTCTCTTTTTTTGAGGACTGCATATTTCTGGAAAGCTGATTTCTATGCATAGCATG

TGTAGACATAACCAGCAATGAAGATTTTAGTCTCATTAAGTTTTTGTGCACAGAAAGATGGGGGTCTTTGGCTCTTTACTAAAGACTTGGAGAACCGGAT

GTTGATGCTGTAAAAGTTCCCTAACAATCAATCTTGTACTTTTTGTATGTTTTTATATACATGTGTATTTAATGAGCACAAGCTTGGTTGTATTTTTTAC

GATTCAGTTGATAGGAAAATGTTTTAAGGCTATAGTTGGCATTGATCAAAGCAGAAGCAAAATTGAGCATTGTTATTTTGTGATTTAAAAGGGGCAGTAT

TTAAGATAAAGGTTTAGGTATCTTATTTGCAGTATTCCACAGTTCTGCTTCTAGACTTCCTGTAATTTTAGCGACCTTTGACAGCAGATTCTGTTTACAT

CAGAATTTGCTTTTGTTTCGGTTTTTTGGAGCCTGGGGATCCAGAACCTGAAGTACTCCAGGCGAGCGCTCTACCATTGAGCTGCGCCTCCAGCCTGAAT

TGAAGTTTGAGCAAAGTACAGTGTTTGCAACTCCAACTGGAAGTTTTTTAAAGTTCTTCAAGTAGTAAAGTAGGTTAGCTTTGTTTGGATGAGTAACTGG

TACTAGTTATGTTATCTTACCATCTGACATGCGACTTTGGTATTTTCTGCTTCTTAAGGAAATTATGAAATATGTAAAACTTAGTGACTTCCTAGGTAAG

AAGAAAACTTGACATTTTCAAAGGCTGTGAATTTTTCTTGGAGGGATTCTACCCCCGGCCCCCAGTAGTTGCTTTAAGTGTATAAGCCCACCAGTTCCAG

ATGATAGGGGATTATGGAGTCATGGTTCCCCTCATTTGAGGAAGAGTGGGCCTGTGTTGTGACCAGGAGTGAGGGAAGGTGAACAGAGTTATTTTTGTTT

GTTTGTGCAAATTATTTTCTATATTAACTCTTTAAGCATTAATGTATAACCGGAAATTTTAAGATGCATGTTATTGTAAGCGCAACATAGTGGTGATTTT

GAGGTCTTTCTCTAAAACATAAGTGGCACATTTTAAATTTCAAGTCTTAAAGTGCCTGAAAGTTATTTGATTCTCTCAACTAATTTCTTTTGAGCCATAT

GTTTCCTCCTTTAAATGTTTGTTGCAGAATCACTAGTCTTCGTTTGAAGTACTCCCACATTTCTAAATGGCATGATTGCTCTATTGAAGACAGTAGAATC

TGTTAACGTAAGACTGAAGAGATTTTATTGTGCAACTGTGTAAACTGGGGCTTTGCCCAGTCGGATCTAAGTATTTTTGTGTACAACTTGGTAAACACCA

TATTGCTGCTGTTTCTAAACCCTCCACCTACCGAATTCTCATGTTCAGCATCGCAGAGGCAGAAATACAAGCATAATCATATATGGGCTTTGTTTCTTTT

CATTGATTTTTCTTAGTGATGATTTCCCAGCCTTTTTTTTTTTTTTTGTCTCTTAGCTATAATTATACAGACCTAGAATTATTCAAATGTTTTCTATTTT

CATGATTAACTTTTATTAGTGGACAATAACAACTTAAGTCTTTAATCCTCATATTGGTTAAAAACATGAGGAGCCTTTTTTATTTGAATTACTTTTGTAA

AAGAAAGCAACAGTCTGAATATTCAGGTGACTACTTTGGCATAGTTCGGGTTTTTATTAGTATTTTTCCAGGTTATGTTTTCCCATGAACTATTTTACTT

TGTTAATTTTGTGCTTAATTTGGTGGCTATATCCTGCCTTATTTAGAATTTTAGAAAATTGCCTTTTTGCGATAAGTGCCCAGTTTTTATTTCTAGTTTG

AAGGTACGAGGACATACAGACTGCTGATAAAAGAAACCAGCACCCCTTTGCCCCAGCTTATGTGTTACCAACAAAACCATTCTCAGTACTGGTTTCATTG

TAGGGCCCAACCAGAATTGGTCCTGCATCTACATGAGTGTTGCATATTTGAAAAGGGTTTGGGTGTGATAAATCACTACAGAAGTGCTGAATGTATTAAG

ACCTCGCTGCCGATTGTATTTCTAACGATTATTTTGTGTTTGCAGAAGTATGTAGCACTTGTCCTCCAAGCTTTCAGGTGTAAGGGGGAAAGGTGAACCA

CATTTTAAAGTCACTAATGAGTGCAATTTTTTTTTTTTTTGGAATTGGGGTTCCCAAAAGGAAATTTCACCGCCCAAATCTCACATACTTCTTAGCCTTT

TACAAGCCAACAGATTGACATAAAGATTGTCCGCAGTTCGTAAGATCTAGCACATATACAAAAATAAAACTTTATAAATTAAA
Translation
 - UNI15532 - MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQ - UNI27370 - TSSPDSSNENSPATPPDEQGQGDAPPQIEDEEPAFPHTDL

AKLDDMINR - UNI26032 - RPRWVVPVLPKGELEVLLEAAIDLSKKG - UNI23994 - GLDVKSEACQRFFRDGLTISFTKILTDEAVSGWKF

EIH - UNI20398 - RCIINNTHRLVELCVAKLAQDWFPLLELLAMALNPHCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPK GWLVDLLNK

FGTLNGFQILHDRFINGSALNVQIIAALIK KPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRVPGQE

ETVKNLEIFRLKMILR RLLQISSFNGKMNALNEVNKVISSVSYYTHRHGSSEDEEWLTAERMA - UNI2 - EWIQQNNILSIVLRDSLHQPQYVEKL

EKILRFVIKEKALTLQDLDNIWAAQ AGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFK ASWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLL

WNLAHSDDVPVDIMDLALSAHIKILDYSCSQ - UNI1775 - DRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLS SQSQRSPHV

FYRHDLINQLQHNHALVTLVAENLATYMESMRMYGRD - UNI12342 - DNEDYDPQTVRLGSRYSHVQEVQERLNFLR - UNI35406 - RFLLK

DGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDL

ELIGLDYLWR - UNI3658 - VVIQSNDDIACRAIDLLKEIYTNLGPRLQVNQ VVIHEDFIQSCFDRLKASYDTLCVLDGDKDSINCARQEAVRMVR

VLTVLREYINECDSDYHEERTILPMSR - UNI10938 - RAFRGKHLSFIVRFPNQGRQVDDLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVG

GELIDPGDDRKLIGQLNLKDKS LITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGV - UNI27599 - IMSLHPRYISFLW

QVADLGSSLNMPPLRDGARVLMKLMPPD - UNI15389 - DSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQVLYLTE VVYALLMPAGAPL

TDDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTS - UNI352 - VNQVTHDQ

AVVLQSALQSIPNPSSECMLRNVSVRLAQQISDE ASRYMPDICVIRAIQKIIWTSGCGGLQLVFSPNEEVTKIYEK - UNI12236 - TNAGNEPDL

EDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSK - UNI18666 - KTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLG S

TARERAKHSGDYFTLLRHLLNYAYNSNINVPNAEVLLNNEIDWLKRIR DDVKRTGETGVEETILEGHLGVTKELLAFQTPEKKFHIGCEKGGANLIK E

LIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINAGFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITT TCEALTEWEYLPPVGPRPPKGFVGL

KNAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNE SNVDPRDDVFGYPQQFEDKPPLSKTEDRKEYNIGVLRHLQVIFGHLAASR

LQYYVPRGFWKQFR RLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHR - UNI10485 - RYECEESFTTLN

VDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKK VDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNV

NPESQLIQQNEQSESEKAGSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYR

RQKRWWNAYILFYERMDTIGHDDEVIRYISEIAITTRPHQIVMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPG - UNI12284

 - GQDHLSPEAEEITMISIQLAARFLFTTGFHTKKIVRGSASDW - UNI11535 - WYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSA

EVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQ - UNI29142 - AYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLFVMYANLG - UNI1

648 - GVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVSSRMQSSING - UNI20507 - GNPSLPNPFGDPNLSQP

IMPIQQNVVDILFVRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSSTVLSELLWQ VAYSYTYELRPYLDLLLQILLIEDSWQTHR - UNI12320 

- RIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAYQILQ GNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNE

TSNGYFLERSHSARMTLAKACELCPEE - UNI2587 - EPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQ - UNI7489 - - UNI16375 - NN

HVHGQPYTGPAAHHMNNPQRTGQRAQENYEGGEEVSPPQT - UNI16375 - - UNI34406 - GSVKCTY
Transcript ENSMUST00000078385
Sequence
CTGTTGCTGCCGCCGTCGCCGCCGCCTCCGACACTGCCACCGCCACCGCCACCACCACCGGCCGTGCGGGTTTTCTTTCTTTTTCTTTCTGTCTTTTCTT

TTCTTTCTTGATTTGTTGGGTTCGCCATATTGACGAGGCTGTGGTACCCAAGGCTGCGGAAGCTAGAGTCCGCCGGTGGCGGAGCC - UNI15532 - 

ACTTACAGGTTATGCAATGGTCTCTGCAAGATGTTTTATTCTTGAATTGGAACCTTTTACGACTGACAAATGCTGGTACTTTATCTCCTATAAGTGGACT

ATAATTTCTTTTCTTAAGACAACTACATAAGCAGACAAAATTGCAAAGATCTGCCCTGTGTCGAGTATGACAGCCACGACTCGTGGCTCTCCAGTTGGAG

GGAATGACAACCAGGGCCAAGCCCCTGATGGACAGTCTCAGCCCCCCCTCCAACAGAATCAG - UNI27370 - ACTTCATCGCCTGATTCGTCCAAT

GAAAATTCCCCTGCAACTCCTCCTGATGAGCAAGGTCAAGGTGATGCTCCTCCACAGATTGAAGATGAGGAACCTGCATTTCCACACACTGACTTGGCAA

AGTTAGATGATATGATCAACAG - UNI26032 - GCCTCGATGGGTTGTTCCAGTTTTGCCGAAAGGGGAATTAGAAGTGCTTTTAGAAGCTGCTATT

GATCTTAGTAAGAAAG - UNI23994 - GCCTTGATGTTAAAAGTGAAGCATGTCAGCGATTTTTCCGAGATGGGCTAACGATCTCATTTACAAAAAT

CCTGACAGATGAAGCAGTGAGTGGCTGGAAGTTTGAAATTCAC - UNI20398 - AGATGCATTATTAACAATACTCATCGCCTGGTGGAGCTATGTG

TGGCTAAGTTAGCCCAAGACTGGTTTCCACTTCTAGAACTTCTTGCCATGGCCTTAAATCCTCATTGCAAATTCCATATCTACAATGGTACACGTCCCTG

CGAGTCAGTGTCCTCAAGTGTTCAGTTGCCTGAAGATGAACTCTTTGCTCGTTCTCCAGACCCTCGATCACCAAAA GGTTGGCTAGTGGATCTCCTCAA

CAAGTTTGGCACTTTAAATGGATTCCAGATACTGCACGATCGTTTTATTAATGGATCAGCATTAAACGTTCAGATAATTGCAGCCCTTATTAA ACCATT

TGGACAGTGCTATGAGTTTCTTACTCTTCACACAGTGAAAAAGTACTTTCTTCCAATAATAGAAATGGTTCCACAGTTTTTAGAAAACTTAACTGATGAA

GAGCTGAAGAAAGAAGCAAAGAATGAAGCCAAAAATGATGCTCTTTCAATGATTATTAAATCATTGAAGAATTTAGCTTCGCGGGTTCCTGGACAAGAAG

AAACTGTAAAAAACTTAGAAATATTTAGGTTAAAAATGATACTTAG ATTGTTGCAAATTTCTTCTTTCAATGGAAAGATGAATGCACTGAATGAGGTTA

ATAAGGTGATTTCCAGTGTGTCATACTATACCCATCGGCATGGCAGTTCTGAGGATGAAGAGTGGCTTACAGCAGAGAGGATGGCT - UNI2 - GAAT

GGATACAGCAGAACAATATTTTATCCATAGTTTTACGAGATAGCCTTCATCAACCACAGTATGTAGAGAAACTAGAAAAGATTCTTCGCTTTGTCATAAA

AGAAAAAGCTCTGACCTTGCAAGATCTTGATAATATCTGGGCAGCACAG GCAGGGAAACATGAAGCCATTGTAAAGAATGTACATGATCTACTGGCCAA

ATTGGCATGGGATTTTTCTCCTGAACAACTTGATCATCTTTTTGATTGCTTTAAG GCCAGTTGGACAAATGCAAGTAAAAAGCAACGTGAAAAGCTCCT

TGAGCTGATTCGTCGTCTTGCAGAAGATGATAAAGATGGTGTGATGGCACATAAAGTATTGAACCTTCTGTGGAATCTAGCTCACAGTGATGATGTGCCT

GTAGATATCATGGATTTGGCTCTCAGTGCTCACATCAAAATACTAGATTATAGTTGCTCCCAG - UNI1775 - GACCGGGACACCCAAAAGATCCAG

TGGATTGATCGCTTCATAGAAGAACTTCGCACAAATGACAAATGGGTCATTCCTGCACTGAAACAAATTAGAGAAATTTGTAGTTTGTTTGGTGAAGCAC

CTCAAAATTTGAG TCAAAGTCAGCGAAGTCCCCATGTATTTTATCGCCATGACTTAATCAATCAACTTCAGCACAATCATGCCCTAGTTACTTTGGTAG

CAGAAAACCTTGCAACTTACATGGAAAGCATGAGAATGTATGGCAGAG - UNI12342 - ACAATGAAGACTATGACCCACAAACTGTGAGACTGGGA

AGTAGATATAGTCATGTTCAAGAAGTCCAAGAACGGCTTAACTTTCTTAG - UNI35406 - GTTTTTATTGAAGGATGGCCAGCTGTGGCTGTGTGC

TCCACAGGCAAAACAAATATGGAAGTGCTTAGCAGAGAATGCGGTTTATCTTTGTGATCGTGAAGCCTGTTTTAAGTGGTATTCCAAATTAATGGGAGAC

GAACCTGACTTAGATCCTGATATCAATAAGGACTTCTTTGAAAGTAATGTGCTTCAGCTTGATCCTTCCCTGTTAACTGAAAATGGGATGAAGTGTTTTG

AGAGATTCTTCAAAGCTGTGAATTGTCGAGAAGGAAAACTAGTAGCAAAAAGAAGAGCCTACATGATGGATGATTTGGAATTGATAGGATTAGACTATCT

TTGGAGA - UNI3658 - GTTGTAATTCAGAGTAATGATGATATTGCCTGCCGAGCTATTGATCTCCTTAAAGAGATATACACAAACCTTGGTCCAAG

GCTGCAGGTCAATCAG GTGGTGATCCATGAAGACTTCATTCAGTCTTGCTTTGATCGTTTGAAAGCCTCTTATGACACATTGTGTGTTTTGGATGGTGA

CAAAGACAGTATTAATTGTGCAAGACAGGAAGCTGTTCGAATGGTCCGAGTGTTAACTGTTCTAAGAGAATATATAAATGAATGTGACAGTGATTATCAT

GAAGAAAGAACAATTTTGCCTATGTCAAG - UNI10938 - AGCTTTCCGTGGTAAACACCTCTCTTTTATAGTTCGATTTCCAAACCAGGGCAGGCA

AGTAGATGACTTGGAGGTTTGGTCTCATACAAATGATACCATTGGTTCAGTTCGAAGATGTATACTCAATCGTATTAAAGCCAATGTAGCTCATACAAAA

ATTGAACTCTTTGTGGGTGGTGAGCTTATTGATCCTGGAGATGACCGAAAGTTGATTGGACAATTAAACCTAAAAGATAAATCA CTAATTACAGCCAAA

CTTACACAAATAAGCTCCAATATGCCTTCAAGTCCTGATAGCTCCTCTGATTCCTCAACTGGATCTCCTGGAAATCATGGTAATCATTACAGTGATGGCC

CCAATCCAGAAGTGGAAAGTTGTTTGCCTGGAGTG - UNI27599 - ATAATGTCACTTCATCCCAGATACATCTCTTTCCTTTGGCAAGTTGCAGAC

TTAGGGAGCAGCCTAAATATGCCACCTCTTAGAGATGGAGCAAGAGTGCTTATGAAACTTATGCCGCCAG - UNI15389 - ATAGTACGACAATAGA

AAAGTTAAGAGCTATTTGTTTGGACCATGCCAAACTTGGAGAAAGCAGCCTTAGTCCATCTCTTGACTCACTTTTCTTTGGTCCTTCAGCCTCACAAGTG

CTATACCTAACAGAG GTAGTCTATGCCTTGTTAATGCCCGCTGGTGCACCCTTGACTGATGATTCCTCGGATTTTCAGTTTCACTTCTTGAAAAGTGGT

GGTCTGCCCCTTGTCCTGAGTATGCTAACCAGAAATAACTTCCTACCAAATGCAGATATGGAAACTCGAAGGGGTGCCTACCTCAATGCTCTTAAAATAG

CCAAACTGTTACTAACTGCCATTGGCTATGGCCATGTTCGTGCTGTGGCAGAAGCTTGTCAACCAGGTGTAGAAGGCGTGAATCCTATGACATCG - UN

I352 - GTCAACCAAGTAACTCATGATCAAGCAGTGGTGCTACAAAGTGCCCTTCAGAGCATTCCTAACCCATCATCTGAATGCATGCTTAGAAACGTG

TCTGTTCGCCTTGCTCAGCAGATTTCTGATGAG GCTTCAAGATATATGCCTGATATTTGTGTAATTAGAGCTATACAAAAAATTATTTGGACATCAGGA

TGTGGAGGATTACAGCTGGTATTCAGCCCAAATGAAGAAGTGACAAAAATTTATGAGAAG - UNI12236 - ACCAATGCAGGCAATGAGCCAGACCT

CGAAGATGAACAGGTTTGCTGTGAAGCATTGGAGGTGATGACACTGTGTTTCGCCTTGATTCCAACAGCCTTAGATGCTCTAAGTAAAGAAAAAGCTTGG

CAGACATTTATTATTGACTTACTGTTGCACTGTCACAGCAA - UNI18666 - AACTGTTCGTCAAGTGGCACAGGAACAATTCTTCTTAATGTGCAC

CAGATGTTGCATGGGGCACAGGCCTCTACTTTTCTTCATTACGCTGCTCTTTACTGTTTTGGGG AGCACAGCCAGAGAGAGGGCTAAACACTCAGGCGA

CTACTTTACTCTTTTAAGACATCTTCTTAATTACGCCTACAACAGTAACATTAATGTGCCCAATGCTGAAGTTCTTCTAAATAATGAAATTGATTGGCTT

AAAAGAATTAGG GATGATGTTAAAAGGACAGGTGAAACAGGTGTTGAGGAGACAATCTTAGAAGGACACCTTGGGGTTACAAAGGAGCTACTGGCTTTT

CAGACTCCTGAGAAAAAGTTTCATATTGGTTGTGAAAAGGGAGGTGCTAATCTCATTAAA GAATTAATCGACGACTTCATCTTTCCCGCATCCAATGTT

TACCTGCAGTATATGAGAAATGGAGAACTCCCTGCTGAGCAGGCCATTCCTGTGTGTGGTTCACCAGCCACAATTAATGCTGGTTTTGAGTTACTTGTGG

CATTAGCTGTTGGCTGTGTGAGGAACCTCAAACAGATAGTAGATTCTTTGACTGAAATGTATTACATTGGTACAGCAATAACTA CTTGTGAAGCACTTA

CTGAGTGGGAATACCTGCCACCCGTTGGACCCCGTCCACCAAAAGGATTTGTGGGGCTGAAAAATGCTGGTGCTACTTGTTACATGAACTCTGTGATCCA

GCAACTCTATATGATCCCCTCTATCAGGAATGGTATTCTTGCCATAGAAGGCACAGGTAGTGATGTAGATGATGATATGTCTGGGGATGAGAAGCAGGAC

AACGAG AGCAATGTTGATCCCAGGGATGATGTGTTTGGATATCCTCAACAATTTGAAGACAAACCACCACTGAGTAAAACAGAAGATAGGAAAGAGTAC

AATATTGGTGTTCTAAGACACCTTCAGGTTATCTTTGGCCATTTAGCTGCTTCTCGACTACAGTACTATGTGCCTAGAGGATTTTGGAAACAGTTCAG G

CTTTGGGGTGAGCCTGTCAATCTTCGTGAACAACATGATGCTTTAGAGTTCTTTAATTCTTTGGTGGATAGTTTAGATGAAGCTTTAAAAGCCTTAGGGC

ATCCAGCTATGCTAAGTAAAGTCTTGGGAGGTTCCTTTGCTGATCAGAAAATTTGCCAAGGCTGCCCACATAG - UNI10485 - GTACGAATGTGAA

GAATCTTTTACGACTCTGAATGTAGACATTAGAAACCACCAAAATCTTCTGGATTCTTTGGAACAGTATGTCAAAGGAGACTTACTAGAAGGAGCAAATG

CTTATCATTGTGAAAAATGCAATAAAAAG GTTGATACTGTAAAGCGCTTGCTAATTAAAAAATTGCCTCCTGTTCTTGCTATCCAACTAAAACGATTCG

ATTATGACTGGGAAAGAGAATGTGCAATCAAGTTCAATGATTACTTTGAATTTCCTCGAGAGTTAGACATGGAACCTTACACAGTGGCAGGTGTTGCTAA

ACTGGAGGGAGATAATGTCAACCCAGAAAGTCAGCTGATACAACAGAATGAGCAGTCTGAAAGCGAGAAAGCAGGAAGCACAAAATACAGACTTGTGGGT

GTGCTTGTGCACAGTGGTCAAGCAAGTGGCGGACATTACTATTCTTACATCATTCAGAGGAATGGAGGGGATGGTGAAAAAAATCGTTGGTATAAATTTG

ATGATGGAGATGTAACGGAATGTAAAATGGATGACGATGAAGAAATGAAAAACCAGTGTTTTGGGGGAGAGTACATGGGAGAAGTATTTGATCACATGAT

GAAGCGCATGTCGTACAGGCGTCAGAAAAGATGGTGGAATGCATATATACTTTTTTATGAACGAATGGACACAATAGGTCATGATGATGAGGTGATAAGA

TACATATCAGAGATTGCTATCACCACAAGGCCCCATCAGATTGTCATGCCATCCGCCATTGAAAGAAGTGTTCGGAAGCAGAATGTTCAGTTCATGCACA

ACCGAATGCAGTACAGTCTGGAATATTTTCAGTTTATGAAAAAGCTACTGACATGTAATGGTGTTTACTTAAACCCTCCTCCAG - UNI12284 - GG

CAAGATCACCTGTCTCCTGAAGCAGAAGAAATCACTATGATTAGTATTCAGCTTGCTGCTAGGTTCCTTTTTACTACAGGATTTCACACAAAGAAAATAG

TCCGAGGATCTGCCAGTGATTG - UNI11535 - GTATGATGCATTGTGTATTCTCCTGCGTCACAGCAAGAACGTGCGGTTTTGGTTTGCTCACAAT

GTCCTTTTTAATGTTTCAAATCGATTCTCTGAGTACCTTTTGGAATGCCCTAGTGCAGAAGTGAGAGGTGCATTTGCAAAGCTCATAGTTTTCATTGCAC

ATTTTTCCTTACAAGACGGGCCTTGTCCTTCACCTTTTGCATCTCCTGGACCTTCTAGTCAG - UNI29142 - GCTTATGACAACTTAAGTTTGAGT

GACCACTTACTAAGAGCAGTACTAAATCTCTTGCGGAGGGAGGTTTCAGAGCATGGACGTCATTTACAGCAGTATTTCAACTTGTTCGTAATGTATGCCA

ATTTAG - UNI1648 - GAGTGGCAGAGAAAACACAGCTGCTCAAACTGAGTGTACCTGCTACCTTTATGCTTGTGTCCTTAGATGAAGGTCCTGGCC

CTCCAATTAAATATCAGTATGCTGAATTAGGCAAATTATACTCAGTAGTGTCACAGCTCATCCGCTGTTGCAATGTCTCTTCAAGAATGCAGTCTTCGAT

CAATG - UNI20507 - GTAATCCTTCTCTTCCAAATCCTTTTGGTGATCCTAACTTATCACAACCTATAATGCCAATTCAACAAAATGTGGTAGACA

TTTTATTTGTGAGAACAAGTTATGTGAAGAAAATTATTGAAGACTGCAGTAACTCTGATGAGACCGTCAAATTGCTTCGCTTTTGCTGCTGGGAGAATCC

TCAGTTCTCATCTACTGTCCTCAGTGAACTTCTTTGGCAG GTTGCATATTCTTATACTTATGAACTCCGGCCCTATTTGGATCTGCTTTTACAAATCTT

ACTGATTGAAGACTCTTGGCAGACTCACAG - UNI12320 - AATTCATAATGCCCTTAAAGGAATTCCAGATGACCGAGATGGGCTGTTTGACACAA

TTCAGCGTTCTAAGAATCACTATCAAAAAAGAGCATACCAGTGTATAAAATGTATGGTAGCCCTCTTTAGCAGTTGTCCTGTTGCTTACCAAATCCTGCA

G GGCAATGGAGATCTTAAAAGGAAATGGACCTGGGCAGTGGAGTGGCTTGGAGATGAACTTGAAAGAAGACCATACACTGGCAATCCTCAGTACACTTA

CAACAATTGGTCTCCTCCAGTGCAAAGCAATGAAACATCAAATGGTTATTTCTTAGAGAGATCACACAGCGCTAGGATGACACTTGCAAAAGCTTGTGAA

CTCTGTCCTGAGGAG - UNI2587 - GAACCAGATGACCAAGATGCCCCAGATGAGCATGAATCACCTCCACCAGAAGATGCTCCTTTATACCCTCAT

TCCCCTGGATCTCAATATCAGCAG - UNI7489 - - UNI16375 - - UNI33227 - - UNI34406 - AATAACCATGTGCATGGACAGCCA

TATACAGGCCCAGCAGCACATCACATGAACAACCCTCAGAGAACTGGCCAACGAGCACAAGAAAATTATGAAGGCGGTGAAGAAGTGTCCCCTCCTCAGA

CCAAGGATCAGTGAAATGCACATATTAA
Translation
 - UNI15532 - MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQ - UNI27370 - TSSPDSSNENSPATPPDEQGQGDAPPQIEDEEPAFPHTDL

AKLDDMINR - UNI26032 - RPRWVVPVLPKGELEVLLEAAIDLSKKG - UNI23994 - GLDVKSEACQRFFRDGLTISFTKILTDEAVSGWKF

EIH - UNI20398 - RCIINNTHRLVELCVAKLAQDWFPLLELLAMALNPHCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPK GWLVDLLNK

FGTLNGFQILHDRFINGSALNVQIIAALIK KPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRVPGQE

ETVKNLEIFRLKMILR RLLQISSFNGKMNALNEVNKVISSVSYYTHRHGSSEDEEWLTAERMA - UNI2 - EWIQQNNILSIVLRDSLHQPQYVEKL

EKILRFVIKEKALTLQDLDNIWAAQ AGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFK ASWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLL

WNLAHSDDVPVDIMDLALSAHIKILDYSCSQ - UNI1775 - DRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLS SQSQRSPHV

FYRHDLINQLQHNHALVTLVAENLATYMESMRMYGRD - UNI12342 - DNEDYDPQTVRLGSRYSHVQEVQERLNFLR - UNI35406 - RFLLK

DGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFFESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDL

ELIGLDYLWR - UNI3658 - VVIQSNDDIACRAIDLLKEIYTNLGPRLQVNQ VVIHEDFIQSCFDRLKASYDTLCVLDGDKDSINCARQEAVRMVR

VLTVLREYINECDSDYHEERTILPMSR - UNI10938 - RAFRGKHLSFIVRFPNQGRQVDDLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVG

GELIDPGDDRKLIGQLNLKDKS LITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGV - UNI27599 - IMSLHPRYISFLW

QVADLGSSLNMPPLRDGARVLMKLMPPD - UNI15389 - DSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQVLYLTE VVYALLMPAGAPL

TDDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTS - UNI352 - VNQVTHDQ

AVVLQSALQSIPNPSSECMLRNVSVRLAQQISDE ASRYMPDICVIRAIQKIIWTSGCGGLQLVFSPNEEVTKIYEK - UNI12236 - TNAGNEPDL

EDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSK - UNI18666 - KTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLG S

TARERAKHSGDYFTLLRHLLNYAYNSNINVPNAEVLLNNEIDWLKRIR DDVKRTGETGVEETILEGHLGVTKELLAFQTPEKKFHIGCEKGGANLIK E

LIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPATINAGFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITT TCEALTEWEYLPPVGPRPPKGFVGL

KNAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNE SNVDPRDDVFGYPQQFEDKPPLSKTEDRKEYNIGVLRHLQVIFGHLAASR

LQYYVPRGFWKQFR RLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHR - UNI10485 - RYECEESFTTLN

VDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKK VDTVKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNV

NPESQLIQQNEQSESEKAGSTKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMSYR

RQKRWWNAYILFYERMDTIGHDDEVIRYISEIAITTRPHQIVMPSAIERSVRKQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPG - UNI12284

 - GQDHLSPEAEEITMISIQLAARFLFTTGFHTKKIVRGSASDW - UNI11535 - WYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSA

EVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQ - UNI29142 - AYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLFVMYANLG - UNI1

648 - GVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVSSRMQSSING - UNI20507 - GNPSLPNPFGDPNLSQP

IMPIQQNVVDILFVRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSSTVLSELLWQ VAYSYTYELRPYLDLLLQILLIEDSWQTHR - UNI12320 

- RIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSSCPVAYQILQ GNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNE

TSNGYFLERSHSARMTLAKACELCPEE - UNI2587 - EPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQ - UNI7489 - - UNI16375 - - 

UNI33227 - - UNI34406 - NNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGGEEVSPPQTKDQ

For any suggestions or comments, please send an email to unitrap@crg.es