Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031012 (Cask)
Chromosomal location
Chr X: 13098173 - 13423682 (-)
Description
calcium/calmodulin-dependent serine protein kinase (MAGUK family) Gene [Source:MGI (curated);Acc:Cask-001]
RefSeq_dna
NM_009806 
RefSeq_peptide
NP_033936.2 
UniGene
Mm.474610 Mm.327591 
MGI
MGI:1309489 
Uniprot/SWISSPROT
O70589 
Uniprot/SPTREMBL
B1AUH5 B1AUI1 B1AUH6 B1AUH7 B1AUH8 Q3TNZ0 Q91VJ0 
Human Ortholog
ENSG00000147044 (CASK)
Omim not available
UniTrap UNI22562
Vector Insertion
Chr X: 13363176 - 13423133
Public Clones (sanger)
Private Clones OST291567 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9451
Vector Insertion
Chr X: 13177482 - 13177583
Public Clones RRD059 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3512
Vector Insertion
Chr X: 13162668 - 13163969
Public Clones AE0541 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2717
Vector Insertion
Chr X: 13138830 - 13145601
Public Clones AL0021 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5268
Vector Insertion
Chr X: 13138640 - 13138830
Public Clones YTA541 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5271
Vector Insertion
Chr X: 13134204 - 13136445
Public Clones YTA553 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115430
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GACTTCTAGCAGCAGAAA GAGCCGTCTCTCAGGTGCTGGACAGCCTG

GAAGAGATTCACGCACTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3

512 - ATATATAAA
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GLLAAER R

AVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - IYK
Transcript ENSMUST00000115431
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GACTTCTAGCAGCAGAAA GAGCCGTCTCTCAGGTGCTGGACAGCCTG

GAAGAGATTCACGCACTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3

512 - CTGTATGACAAAATTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATT

TCATGTTACCCTGAGAATAATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTT

CAGACTCATGATGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAA

GTGCAAACGGAGACATGGACATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCA

CTTTGAAAATGAATGAGCTAAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTG

GTGATGAAATCCGAGAAATCAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCA

AGATTGTGCCAAGCTACCGCACTCAGTCTTCGTCCTGTGAGGTAATAAGTCTAACAAGCCTCTCCTACCCCCAA CCCATCTCCTCTGAGTTCTTAACTA

ACTGTCTGCTGATGGCTGAATGTTTTTGCTTTCTGGGAAATTGTTTCTGC GCTGTTAGATCACTGCACACCAATTTTACAACAAAGATAACGGAACAG 

GAGGTCCCACCCACCTCCTCAGCCCTACTTGCATGTAGATATCTTCAGCCTTTTTGCAGCAAAATCAAAGCCAAATATAGAAAAGCTACA
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GLLAAER R

AVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRI

LTQPHFM - UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UN

I5268 - GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSC

EVISLTSLSYPQ PISSEFLTNCLLMAECFCFLGNCFC AVRSLHTNFTTKITEQ EVPPTSSALLACRYLQPFCSKIKAKYRKAT
Transcript ENSMUST00000115432
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GACTTCTAGCAGCAGAAA GAGCCGTCTCTCAGGTGCTGGACAGCCTG

GAAGAGATTCACGCACTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3

512 - CTGTATGACAAAATTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATT

TCATGTTACCCTGAGAATAATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTT

CAGACTCATGATGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAA

GTGCAAACGGAGACATGGACATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCA

CTTTGAAAATGAATGAGCTAAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTG

GTGATGAAATCCGAGAAATCAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCA

AGATTGTGCCAAGCTACCGCACTCAGTCTTCGTCCTGTGAG AGAGATTCCCCCTCCACTTCCAGACAGTCCCCTGCTAATGGTCATAGCAGCACTAACA

ATTCTGTTTCG GACTTGCCATCAACCACCCAACCAAAAGGACGACAG ATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTCATC

CCCTGCAAAGAAGCTGGCATCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGACCACAACTGGTGGCAGGGTAAACTGGAAAACTCCA

AAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAAGAGCAGCAGGCCAGCT

GTACTTGGTTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAACGCAG TTTGATCAATTAGATCTTGTCACATATGAAGAAGTA

GTCAAACTGCCAGCATTCAAAAGGAAAACATTAGTCTTATTAG GTGCACATGGTGTTGGAAGAAGACACATAAAAAATACCCTCATCACAAAGCACCCG

GACCGGTTTGCGTACCCTATTCCAC ATACAACCAGACCTCCAAAGAAAGATGAAGAAAATGGCAAGAATTATTACTTTGTATCTCATGACCAAATGATG

CAAGACATCTCAAATAACGAATACTTGGAGTATGGCAGCCATGAGGATGCAATGTACGGGACAAAACTGGAGACCATTCGGAAAATCCATGAGCAGGGGC

TGATTGCGATTCTGGACGTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCAGAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCACTC

CAGGTTTAAATGAG CTGCCAAAATGGTGCAGAAAATTGCCT GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTCTTGCAGAGAACATATGCA

CACTACTTCGATCTCACAATTATCAACAACGAAATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCACAGCCCCACAGTGGGTCC

CAGTCTCCTGGGTCTATTAGGCTTCTCCTTGGCTATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTTTGTTATCGGCCTTGTGTC

AGCAGGTCGTGGTCCCTAGAGACTACCTAGTTGTAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGGAGAAAATCAATTACACAC

TAATTTAAAGAGACAGTATCTTTTTTAATCAGTTCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAATCCTTTGGAATGTTATATT

TTTGGAAATCATAGCTTTTTATTTCCAAGGCCCCTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAATAATAAACAATGATTCTG

TTACCTTGACTGGGGGTGGAACACTACATTCTTTTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTATTTGAAATGATTAGTCTAG

TGATTACAAAACAGTCATAAATTTTTAAAGGCCTGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGATACTGTCTCTTTGAAGCA

CCCTGTAAACCTTTTAGAGATTTGAAGTTGGGTCTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTGTGTCTGTGTTGGACAAAA

CAATCTGTAATTACAGCCAAGTACATTCCGTTCACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTTGTAAACCTATGCACATCC

CTTGCATTTCGGGCAACTTTATAAAACAGAAAAAAAAAACCTGATTTTTATTAATAATAATCATGTAGTGAAATGTGTTTGTAATTTTGTCTCAATTTAA

TTTGTTGTAAGGTGGGAGGGGGTATTGCTGGTTTCGCCATTTCAGATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAGCAAAGAAATGCGGATTTT

TAATCTGTATGTAATTGTTTTAAGCACCCATTTAAAGAGAATATACTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACAAACTGAATTATTCCAAAA

GAATAATCTATAACAGCCCTGTAAATTCCTTTAAAATGATAACT
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GLLAAER R

AVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRI

LTQPHFM - UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UN

I5268 - GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSC

E RDSPSTSRQSPANGHSSTNNSVS DLPSTTQPKGRQ IYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSP

ELQEW WRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAV V     
Transcript ENSMUST00000115435
Sequence
ATGCCACCTCATCACAACTCAGGCACACATCTAAGCAAACTAATGACTTGTACAGATTTGCCACGTTTTGGAAAG GCACTGAAGGTCCTGAGGACTGCA

GAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCACTCCAGGTTTAAATGAG GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTC

TTGCAGAGAACATATGCACACTACTTCGATCTCACAATTATCAACAACGAAATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCA

CAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCTATTAGGCTTCTCCTTGGCTATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTT

TGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCCCTAGAGACTACCTAGTTGTAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGG

AGAAAATCAATTACACACTAATTTAAAGAGACAGTATCTTTTTTAATCAGTTCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAAT

CCTTTGGAATGTTATATTTTTGGAAATCATAGCTTTTTATTTCCAAGGCCCCTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAA

TAATAAACAATGATTCTGTTACCTTGACTGGGGGTGGAACACTACATTCTTTTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTAT

TTGAAATGATTAGTCTAGTGATTACAAAACAGTCATAAATTTTTAAAGGCCTGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGA

TACTGTCTCTTTGAAGCACCCTGTAAACCTTTTAGAGATTTGAAGTTGGGTCTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTG

TGTCTGTGTTGGACAAAACAATCTGTAATTACAGCCAAGTACATTCCGTTCACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGAC
Translation
MPPHHNSGTHLSKLMTCTDLPRFGK ALKVLRTAEFAPFVVFIAAPTITPGLNE DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELV

CTAPQWVPVSWVY
Transcript ENSMUST00000115436
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GACTTCTAGCAGCAGAAA GAGCCGTCTCTCAGGTGCTGGACAGCCTG

GAAGAGATTCACGCACTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3

512 - CTGTATGACAAAATTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATT

TCATGTTACCCTGAGAATAATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTT

CAGACTCATGATGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAA

GTGCAAACGGAGACATGGACATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCA

CTTTGAAAATGAATGAGCTAAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTG

GTGATGAAATCCGAGAAATCAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCA

AGATTGTGCCAAGCTACCGCACTCAGTCTTCGTCCTGTGAG ATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTCATCCCCTGCA

AAGAAGCTGGCATCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGACCACAACTGGTGGCAGGGTAAACTGGAAAACTCCAAAAATGG

AACTGCAGGTCTCATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAAGAGCAGCAGGCCAGCTGTACTTG

GTTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAACGCAG TGTTTGATCAATTAGATCTTGTCACATATGAAGAAGTAGTCAA

ACTGCCAGCATTCAAAAGGAAAACATTAGTCTTATTAG GTGCACATGGTGTTGGAAGAAGACACATAAAAAATACCCTCATCACAAAGCACCCGGACCG

GTTTGCGTACCCTATTCCAC ATACAACCAGACCTCCAAAGAAAGATGAAGAAAATGGCAAGAATTATTACTTTGTATCTCATGACCAAATGATGCAAGA

CATCTCAAATAACGAATACTTGGAGTATGGCAGCCATGAGGATGCAATGTACGGGACAAAACTGGAGACCATTCGGAAAATCCATGAGCAGGGGCTGATT

GCGATTCTGGACGTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCAGAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCACTCCAGGT

TTAAATGAG GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTCTTGCAGAGAACATATGCACACTACTTCGATCTCACAATTATCAACAACGAA

ATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCACAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCTATTAGGCTTCTCCTTGGC

TATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTTTGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCCCTAGAGACTACCTAGTTG

TAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGGAGAAAATCAATTACACACTAATTTAAAGAGACAGTATCTTTTTTAATCAGT

TCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAATCCTTTGGAATGTTATATTTTTGGAAATCATAGCTTTTTATTTCCAAGGCCC

CTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAATAATAAACAATGATTCTGTTACCTTGACTGGGGGTGGAACACTACATTCTT

TTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTATTTGAAATGATTAGTCTAGTGATTACAAAACAGTCATAAATTTTTAAAGGCC

TGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGATACTGTCTCTTTGAAGCACCCTGTAAACCTTTTAGAGATTTGAAGTTGGGT

CTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTGTGTCTGTGTTGGACAAAACAATCTGTAATTACAGCCAAGTACATTCCGTTC

ACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTTGTAAACCTATGCACATCCCTTGCATTTCGGGCAACTTTATAAAACAGAAAA

AAAAAACCTGATTTTTATTAATAATAATCATGTAGTGAAATGTGTTTGTAATTTTGTCTCAATTTAATTTGTTGTAAGGTGGGAGGGGGTATTGCTGGTT

TCGCCATTTCAGATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAGCAAAGAAATGCGGATTTTTAATCTGTATGTAATTGTTTTAAGCACCCATTT

AAAGAGAATATACTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACAAACTGAATTATTCCAAAAGAATAATCTATAACAGCCCTGTAAATTCCTTTA

AAATGATAACT
Translation
 - UNI22562 -         - UNI9451 -  - UNI9451 -   - UNI3512 -   - UNI2717 - - UNI5268 -  - UNI5268 - 

MIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSCE IYVRAQFEYDPAKDDLIPCKEAGIRFR

VGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEW WRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAV VFDQLDLVTYEEVVKLPAF

KRKTLVLLG GAHGVGRRHIKNTLITKHPDRFAYPIPH HTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIA

ILDVEPQ ALKVLRTAEFAPFVVFIAAPTITPGLNE DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY
Transcript ENSMUST00000115440
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GAGCCGTCTCTCAGGTGCTGGACAGCCTGGAAGAGATTCACGCACTTA

CAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3512 - CTGTATGACAAAA

TTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATTTCATGTTACCCTGAGAATA

ATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTTCAGACTCATGATGTAGTGG

CACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAAGTGCAAACGGAGACATGGA

CATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCACTTTGAAAATGAATGAGCT

AAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTGGTGATGAAATCCGAGAAAT

CAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCAAGATTGTGCCAAGCTACCG

CACTCAGTCTTCGTCCTGTGAG GACTTGCCATCAACCACCCAACCAAAAGGACGACAG ATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGG

ATGACCTCATCCCCTGCAAAGAAGCTGGCATCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGACCACAACTGGTGGCAGGGTAAACT

GGAAAACTCCAAAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAAGAGCA

GCAGGCCAGCTGTACTTGGTTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAACGCAG TGTTTGATCAATTAGATCTTGTCAC

ATATGAAGAAGTAGTCAAACTGCCAGCATTCAAAAGGAAAACATTAGTCTTATTAG GTGCACATGGTGTTGGAAGAAGACACATAAAAAATACCCTCAT

CACAAAGCACCCGGACCGGTTTGCGTACCCTATTCCAC ATACAACCAGACCTCCAAAGAAAGATGAAGAAAATGGCAAGAATTATTACTTTGTATCTCA

TGACCAAATGATGCAAGACATCTCAAATAACGAATACTTGGAGTATGGCAGCCATGAGGATGCAATGTACGGGACAAAACTGGAGACCATTCGGAAAATC

CATGAGCAGGGGCTGATTGCGATTCTGGACGTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCAGAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCG

CCAACTATCACTCCAGGTTTAAATGAG GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTCTTGCAGAGAACATATGCACACTACTTCGATCTC

ACAATTATCAACAACGAAATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCACAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCT

ATTAGGCTTCTCCTTGGCTATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTTTGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCC

CTAGAGACTACCTAGTTGTAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGGAGAAAATCAATTACACACTAATTTAAAGAGACA

GTATCTTTTTTAATCAGTTCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAATCCTTTGGAATGTTATATTTTTGGAAATCATAGC

TTTTTATTTCCAAGGCCCCTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAATAATAAACAATGATTCTGTTACCTTGACTGGGG

GTGGAACACTACATTCTTTTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTATTTGAAATGATTAGTCTAGTGATTACAAAACAGT

CATAAATTTTTAAAGGCCTGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGATACTGTCTCTTTGAAGCACCCTGTAAACCTTTT

AGAGATTTGAAGTTGGGTCTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTGTGTCTGTGTTGGACAAAACAATCTGTAATTACA

GCCAAGTACATTCCGTTCACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTTGTAAACCTATGCACATCCCTTGCATTTCGGGCA

ACTTTATAAAACAGAAAAAAAAAACCTGATTTTTATTAATAATAATCATGTAGTGAAATGTGTTTGTAATTTTGTCTCAATTTAATTTGTTGTAAGGTGG

GAGGGGGTATTGCTGGTTTCGCCATTTCAGATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAGCAAAGAAATGCGGATTTTTAATCTGTATGTAAT

TGTTTTAAGCACCCATTTAAAGAGAATATACTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACAAACTGAATTATTCCAAAAGAATAATCTATAACA

GCCCTGTAAATTCCTTTAAAATGATAACT
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GAVSQVLDS

LEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRILTQPHFM 

- UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UNI5268 - 

GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSCE DLPSTT

QPKGRQ IYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEW WRVACIAMEKTKQEQQASCTWFGKKK

KQYKDKYLAKHNAV VFDQLDLVTYEEVVKLPAFKRKTLVLLG GAHGVGRRHIKNTLITKHPDRFAYPIPH HTTRPPKKDEENGKNYYFVSHDQMMQD

ISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ ALKVLRTAEFAPFVVFIAAPTITPGLNE DESLQRLQKESDVLQRTYAHYFDLTIINN

EIDETIRHLEEAVELVCTAPQWVPVSWVY
Transcript ENSMUST00000033321
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GAGCCGTCTCTCAGGTGCTGGACAGCCTGGAAGAGATTCACGCACTTA

CAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3512 - CTGTATGACAAAA

TTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATTTCATGTTACCCTGAGAATA

ATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTTCAGACTCATGATGTAGTGG

CACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAAGTGCAAACGGAGACATGGA

CATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCACTTTGAAAATGAATGAGCT

AAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTGGTGATGAAATCCGAGAAAT

CAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCAAGATTGTGCCAAGCTACCG

CACTCAGTCTTCGTCCTGTGAG AGAGATTCCCCCTCCACTTCCAGACAGTCCCCTGCTAATGGTCATAGCAGCACTAACAATTCTGTTTCG ATCTATG

TAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTCATCCCCTGCAAAGAAGCTGGCATCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAG

TAAGGATGACCACAACTGGTGGCAGGGTAAACTGGAAAACTCCAAAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGC

TTGCATTGCCATGGAGAAGACCAAACAAGAGCAGCAGGCCAGCTGTACTTGGTTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCAC

AACGCAG TGTTTGATCAATTAGATCTTGTCACATATGAAGAAGTAGTCAAACTGCCAGCATTCAAAAGGAAAACATTAGTCTTATTAG GTGCACATGG

TGTTGGAAGAAGACACATAAAAAATACCCTCATCACAAAGCACCCGGACCGGTTTGCGTACCCTATTCCAC ATACAACCAGACCTCCAAAGAAAGATGA

AGAAAATGGCAAGAATTATTACTTTGTATCTCATGACCAAATGATGCAAGACATCTCAAATAACGAATACTTGGAGTATGGCAGCCATGAGGATGCAATG

TACGGGACAAAACTGGAGACCATTCGGAAAATCCATGAGCAGGGGCTGATTGCGATTCTGGACGTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCA

GAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCACTCCAGGTTTAAATGAG GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTC

TTGCAGAGAACATATGCACACTACTTCGATCTCACAATTATCAACAACGAAATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCA

CAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCTATTAGGCTTCTCCTTGGCTATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTT

TGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCCCTAGAGACTACCTAGTTGTAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGG

AGAAAATCAATTACACACTAATTTAAAGAGACAGTATCTTTTTTAATCAGTTCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAAT

CCTTTGGAATGTTATATTTTTGGAAATCATAGCTTTTTATTTCCAAGGCCCCTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAA

TAATAAACAATGATTCTGTTACCTTGACTGGGGGTGGAACACTACATTCTTTTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTAT

TTGAAATGATTAGTCTAGTGATTACAAAACAGTCATAAATTTTTAAAGGCCTGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGA

TACTGTCTCTTTGAAGCACCCTGTAAACCTTTTAGAGATTTGAAGTTGGGTCTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTG

TGTCTGTGTTGGACAAAACAATCTGTAATTACAGCCAAGTACATTCCGTTCACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTT

GTAAACCTATGCACATCCCTTGCATTTCGGGCAACTTTATAAAACAGAAAAAAAAAACCTGATTTTTATTAATAATAATCATGTAGTGAAATGTGTTTGT

AATTTTGTCTCAATTTAATTTGTTGTAAGGTGGGAGGGGGTATTGCTGGTTTCGCCATTTCAGATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAG

CAAAGAAATGCGGATTTTTAATCTGTATGTAATTGTTTTAAGCACCCATTTAAAGAGAATATACTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACA

AACTGAATTATTCCAAAAGAATAATCTATAACAGCCCTGTAAATTCCTTTAAAATGATAACT
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GAVSQVLDS

LEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRILTQPHFM 

- UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UNI5268 - 

GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSCE RDSPST

SRQSPANGHSSTNNSVS IYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEW WRVACIAMEKTKQEQ

QASCTWFGKKKKQYKDKYLAKHNAV VFDQLDLVTYEEVVKLPAFKRKTLVLLG GAHGVGRRHIKNTLITKHPDRFAYPIPH HTTRPPKKDEENGKNY

YFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ ALKVLRTAEFAPFVVFIAAPTITPGLNE DESLQRLQKESDVLQRTY

AHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY
Transcript ENSMUST00000115438
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GAGCCGTCTCTCAGGTGCTGGACAGCCTGGAAGAGATTCACGCACTTA

CAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3512 - CTGTATGACAAAA

TTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATTTCATGTTACCCTGAGAATA

ATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTTCAGACTCATGATGTAGTGG

CACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAAGTGCAAACGGAGACATGGA

CATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCACTTTGAAAATGAATGAGCT

AAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTGGTGATGAAATCCGAGAAAT

CAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCAAGATTGTGCCAAGCTACCG

CACTCAGTCTTCGTCCTGTGAG AGAGATTCCCCCTCCACTTCCAGACAGTCCCCTGCTAATGGTCATAGCAGCACTAACAATTCTGTTTCG GACTTGC

CATCAACCACCCAACCAAAAGGACGACAG ATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTCATCCCCTGCAAAGAAGCTGGCA

TCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGACCACAACTGGTGGCAGGGTAAACTGGAAAACTCCAAAAATGGAACTGCAGGTCT

CATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAAGAGCAGCAGGCCAGCTGTACTTGGTTTGGCAAGAA

AAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAACGCAG TGTTTGATCAATTAGATCTTGTCACATATGAAGAAGTAGTCAAACTGCCAGCATT

CAAAAGGAAAACATTAGTCTTATTAG GTGCACATGGTGTTGGAAGAAGACACATAAAAAATACCCTCATCACAAAGCACCCGGACCGGTTTGCGTACCC

TATTCCAC ATACAACCAGACCTCCAAAGAAAGATGAAGAAAATGGCAAGAATTATTACTTTGTATCTCATGACCAAATGATGCAAGACATCTCAAATAA

CGAATACTTGGAGTATGGCAGCCATGAGGATGCAATGTACGGGACAAAACTGGAGACCATTCGGAAAATCCATGAGCAGGGGCTGATTGCGATTCTGGAC

GTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCAGAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCACTCCAGGTTTAAATGAG GA

TGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTCTTGCAGAGAACATATGCACACTACTTCGATCTCACAATTATCAACAACGAAATTGATGAGACA

ATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCACAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCTATTAGGCTTCTCCTTGGCTATCTGAGTATA

AAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTTTGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCCCTAGAGACTACCTAGTTGTAGTGTGACCTA

CATTTATAATTATTGTCATGTCCGAATAGATAGGAGGAGAAAATCAATTACACACTAATTTAAAGAGACAGTATCTTTTTTAATCAGTTCTCCTAAACTT

TAATAAAATGTATCTTTAAATGTATGTATTATTCAATCCTTTGGAATGTTATATTTTTGGAAATCATAGCTTTTTATTTCCAAGGCCCCTAAAAACTGCA

CAAAATAGATGCTGCTTTCTATAATCTATTTTAATAATAATAAACAATGATTCTGTTACCTTGACTGGGGGTGGAACACTACATTCTTTTTAGAGTCTGA

TTTTATGGATTGGAATACCTTTCTTTCCTTTATTTATTTGAAATGATTAGTCTAGTGATTACAAAACAGTCATAAATTTTTAAAGGCCTGTTTTCTCTCT

TTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGATACTGTCTCTTTGAAGCACCCTGTAAACCTTTTAGAGATTTGAAGTTGGGTCTTGACTCTTAA

TGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTGTGTCTGTGTTGGACAAAACAATCTGTAATTACAGCCAAGTACATTCCGTTCACGGGGCACACC

CAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTTGTAAACCTATGCACATCCCTTGCATTTCGGGCAACTTTATAAAACAGAAAAAAAAAACCTGAT

TTTTATTAATAATAATCATGTAGTGAAATGTGTTTGTAATTTTGTCTCAATTTAATTTGTTGTAAGGTGGGAGGGGGTATTGCTGGTTTCGCCATTTCAG

ATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAGCAAAGAAATGCGGATTTTTAATCTGTATGTAATTGTTTTAAGCACCCATTTAAAGAGAATATA

CTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACAAACTGAATTATTCCAAAAGAATAATCTATAACAGCCCTGTAAATTCCTTTAAAATGATAACT
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GAVSQVLDS

LEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRILTQPHFM 

- UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UNI5268 - 

GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSCE RDSPST

SRQSPANGHSSTNNSVS DLPSTTQPKGRQ IYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEW WR

VACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAV VFDQLDLVTYEEVVKLPAFKRKTLVLLG GAHGVGRRHIKNTLITKHPDRFAYPIPH HTT

RPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ ALKVLRTAEFAPFVVFIAAPTITPGLNE DESLQ

RLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY
Transcript ENSMUST00000116623
Sequence
CGCGGATCAGCCGCCACCACCTCCCTTCGCGACGATCCTCCCTCCATGGTGCTGCCGCGGCCCCCCCTGTAGCCCGAGCTGCCCCGCGCCGCGCCGGAGC

CGGTCTCGGGCAGAGGGAGCGGTCGCGGCCTCGCGGCCCGCGCGGGCTGACGAGCGGAGAGTGCGGCGCTTCGCGGTCCCCGAGGGTCCGCACGCCCCGG

CAGCGCGGTCGCCAGCCACCGCGCGAGGAGCAGCGGGCGGGCGGGCGGCGCCGGGCCCGGGCCGCCCTCGCTCCCACGCCCCGGCCCCGCCGCCCGCGCC

GGGGCGGCAGCCGGCAGAGGAAAGGCGCTGCAGTCTCCGGGCCTCACGGCCCCAGTCGAGCTTCCTCAGCACCGAGGGCTTGCGGGTCCTGAGTGGAGGA

CACGAGCCCGGAGCCGGGCACTGAGCTCTTGGGCGCCCCCAACCCAGTTTTCAGAACCCTCCACGCTGCGGCCGCTGTCCCCTTCGGACCATGGCCGACG

ACGACGTGCTGTTCGAGGATGTGTACGAGCTATGCGAGGTGATCGGCAA - UNI22562 - GGGTCCCTTCAGTGTTGTACGGCGATGTATCAACAGA

GAAACTGGGCAACAATTTGCTGTAAAAATTGTTGATGTAGCCAAGTTCACATCAAGTCCAGGGTTAAGTACAGAAG ATCTAAAGCGGGAAGCCAGTATC

TGTCATATGCTGAAGCATCCACACATTGTAGAGCTGTTGGAGACATATAGCTCAGATGGGATGCTTTACATGGTTTTTGAATT TATGGATGGAGCAGAT

CTGTGTTTTGAAATCGTAAAGCGAGCTGATGCTGGTTTTGTATACAGTGAAGCTGTAGCCAG CCACTACATGAGACAGATACTGGAAGCTCTGCGCTAC

TGTCATGATAATAACATAATTCACAGGGACGTGAAG CCCCACTGTGTTCTCCTTGCCTCAAAAGAAAACTCGGCACCTGTTAAACTTGGGGGCTTTGGG

GTGGCCATTCAGTTAGGAGAATCTGGACTTGTTGCTGGAG GCCGCGTTGGAACACCTCACTTTATGGCCCCAGAAGTGGTCAAGAGAGAGCCTTACGGA

AAGCCTGTGGATGTCTGGGGCTGTGGTGTGATCCTTTTCATCCTGCTCAGTGGCTGTTTGCCTTTCTACGGAACCAAGGAAAGATTGTTTGAAGGCATTA

TTAAAGGAAAATATAAG ATGAATCCAAGGCAGTGGAGCCATATCTCTGAAAGTGCCAAAGACCTAGTACGCCGCATGCTGATGCTGGATCCTGCTGAAA

GGATCACTGTTTATGAAGCACTGAATCACCCATGGCTTAAG GAGCGGGATCGTTATGCCTACAAAATCCATCTTCCAGAAACAGTAGAACAACTGAGGA

AATTCAATGCAAGGAGAAAACTAAAG - UNI9451 - GGTGCAGTACTAGCTGCTGTGTCAAGTCACAAATTCAATTCCTTCTATGGGGACCCTCCTG

AAGAGTTGCCAGATTTCTCCGAAGACCCTACCTCCTCAG - UNI9451 - GACTTCTAGCAGCAGAAA GAGCCGTCTCTCAGGTGCTGGACAGCCTG

GAAGAGATTCACGCACTTACAGACTGCAGTGAAAAGGACCTAGATTTTCTACACAGTGTTTTCCAGGATCAACATCTTCACACACTGCTGGAT - UNI3

512 - CTGTATGACAAAATTAACACAAAGTCTTCGCCACAAATCAGGAATCCTCCAAGTGATGCAGTACAGAGAGCCAAAGAG GTATTGGAAGAAATT

TCATGTTACCCTGAGAATAATGATGCGAAGGAACTAAAGCGTATTTTAACACAACCTCATTTCATG - UNI2717 - - UNI5268 - GCCTTACTT

CAGACTCATGATGTAGTGGCACATGAAGTTTACAGTGATGAAGCATTAAGGGTCACACCTCCCCCGACTTCCCCCTATTTAAACGGTGATTCTCCAGAAA

GTGCAAACGGAGACATGGACATGGAGAATGTGACCAGAGTTCGGCTGGTACAGTTCCAAAAGAACACGGATGAGCCAATG - UNI5268 - GGAATCA

CTTTGAAAATGAATGAGCTAAATCATTGTATTGTCGCAAGAATCATGCATGGGGGTATGATTCACAGGCAAG - UNI5271 - GTACACTTCATGTTG

GTGATGAAATCCGAGAAATCAATGGCATCAGTGTCGCTAACCAAACAGTGGAACAGCTACAGAAAATGCTT AGGGAAATGCGAGGGAGTATTACCTTCA

AGATTGTGCCAAGCTACCGCACTCAGTCTTCGTCCTGTGAG AGAGATTCCCCCTCCACTTCCAGACAGTCCCCTGCTAATGGTCATAGCAGCACTAACA

ATTCTGTTTCG GACTTGCCATCAACCACCCAACCAAAAGGACGACAG ATCTATGTAAGAGCACAATTTGAATATGATCCAGCCAAGGATGACCTCATC

CCCTGCAAAGAAGCTGGCATCCGGTTCCGAGTTGGTGACATCATCCAGATTATTAGTAAGGATGACCACAACTGGTGGCAGGGTAAACTGGAAAACTCCA

AAAATGGAACTGCAGGTCTCATTCCTTCTCCTGAACTTCAGGAATG GCGAGTAGCTTGCATTGCCATGGAGAAGACCAAACAAGAGCAGCAGGCCAGCT

GTACTTGGTTTGGCAAGAAAAAGAAGCAGTACAAAGATAAATATTTGGCAAAGCACAACGCAG TGTTTGATCAATTAGATCTTGTCACATATGAAGAAG

TAGTCAAACTGCCAGCATTCAAAAGGAAAACATTAGTCTTATTAG GTGCACATGGTGTTGGAAGAAGACACATAAAAAATACCCTCATCACAAAGCACC

CGGACCGGTTTGCGTACCCTATTCCAC ATACAACCAGACCTCCAAAGAAAGATGAAGAAAATGGCAAGAATTATTACTTTGTATCTCATGACCAAATGA

TGCAAGACATCTCAAATAACGAATACTTGGAGTATGGCAGCCATGAGGATGCAATGTACGGGACAAAACTGGAGACCATTCGGAAAATCCATGAGCAGGG

GCTGATTGCGATTCTGGACGTGGAGCCTCAG GCACTGAAGGTCCTGAGGACTGCAGAGTTTGCTCCTTTTGTTGTCTTCATTGCGGCGCCAACTATCAC

TCCAGGTTTAAATGAG GATGAATCTCTTCAGCGCCTGCAGAAGGAGTCCGATGTCTTGCAGAGAACATATGCACACTACTTCGATCTCACAATTATCAA

CAACGAAATTGATGAGACAATCAGACATCTGGAAGAAGCTGTCGAGCTTGTGTGCACAGCCCCACAGTGGGTCCCAGTCTCCTGGGTCTATTAGGCTTCT

CCTTGGCTATCTGAGTATAAAACTGGGAGCCACCTCCTACGTGGAAAAAGCCTCTTTGTTATCGGCCTTGTGTCAGCAGGTCGTGGTCCCTAGAGACTAC

CTAGTTGTAGTGTGACCTACATTTATAATTATTGTCATGTCCGAATAGATAGGAGGAGAAAATCAATTACACACTAATTTAAAGAGACAGTATCTTTTTT

AATCAGTTCTCCTAAACTTTAATAAAATGTATCTTTAAATGTATGTATTATTCAATCCTTTGGAATGTTATATTTTTGGAAATCATAGCTTTTTATTTCC

AAGGCCCCTAAAAACTGCACAAAATAGATGCTGCTTTCTATAATCTATTTTAATAATAATAAACAATGATTCTGTTACCTTGACTGGGGGTGGAACACTA

CATTCTTTTTAGAGTCTGATTTTATGGATTGGAATACCTTTCTTTCCTTTATTTATTTGAAATGATTAGTCTAGTGATTACAAAACAGTCATAAATTTTT

AAAGGCCTGTTTTCTCTCTTTTTTTAAGTCCTTTATGTAACATGCGGATACTGTGATACTGTCTCTTTGAAGCACCCTGTAAACCTTTTAGAGATTTGAA

GTTGGGTCTTGACTCTTAATGCATGTGGACAGTCGCGAGCGTTTATGCTGTCGGTGTGTCTGTGTTGGACAAAACAATCTGTAATTACAGCCAAGTACAT

TCCGTTCACGGGGCACACCCAGGGGAGTAAGAATAAATTGCTATTATGACTAAGTTGTAAACCTATGCACATCCCTTGCATTTCGGGCAACTTTATAAAA

CAGAAAAAAAAAACCTGATTTTTATTAATAATAATCATGTAGTGAAATGTGTTTGTAATTTTGTCTCAATTTAATTTGTTGTAAGGTGGGAGGGGGTATT

GCTGGTTTCGCCATTTCAGATCTGTGTTGTCTAAGAGTATTAACGTTTTAATTAAGCAAAGAAATGCGGATTTTTAATCTGTATGTAATTGTTTTAAGCA

CCCATTTAAAGAGAATATACTGTGCAATGAAGAAACCAGTTTAGGCATTTGCTACAAACTGAATTATTCCAAAAGAATAATCTATAACAGCCCTGTAAAT

TCCTTTAAAATGATAACT
Translation
MADDDVLFEDVYELCEVIGK - UNI22562 - KGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTED DLKREASICHMLKHPHIVELLETYSS

DGMLYMVFEF FMDGADLCFEIVKRADAGFVYSEAVAS SHYMRQILEALRYCHDNNIIHRDVK PHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGG

 GRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYK MNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPW

LK ERDRYAYKIHLPETVEQLRKFNARRKLK - UNI9451 - GAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSG - UNI9451 - GLLAAER R

AVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLD - UNI3512 - LYDKINTKSSPQIRNPPSDAVQRAKE VLEEISCYPENNDAKELKRI

LTQPHFM - UNI2717 - - UNI5268 - ALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM - UN

I5268 - GITLKMNELNHCIVARIMHGGMIHRQG - UNI5271 - GTLHVGDEIREINGISVANQTVEQLQKML REMRGSITFKIVPSYRTQSSSC

E RDSPSTSRQSPANGHSSTNNSVS DLPSTTQPKGRQ IYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSP

ELQEW WRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAV VFDQLDLVTYEEVVKLPAFKRKTLVLLG GAHGVGRRHIKNTLITKHPDRFAY

PIPH HTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ ALKVLRTAEFAPFVVFIAAPTITPGL

NE DESLQRLQKESDVLQRTYAHYFDLTIINNEIDETIRHLEEAVELVCTAPQWVPVSWVY

For any suggestions or comments, please send an email to unitrap@crg.es