Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031022 (BC051019)
Chromosomal location
Chr 7: 116855696 - 116867364 (-)
Description
Uncharacterized protein C11orf16 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q9JJR6]
RefSeq_dna
NM_001040700 
RefSeq_peptide
NP_001035790.1 
UniGene
Mm.358682 
MGI
MGI:1928824 
Uniprot/SWISSPROT
Q9JJR6 
Uniprot/SPTREMBL
Q3UQ01 
Human Ortholog
ENSG00000176029 (C11orf16)
Omim not available
UniTrap UNI30398
Vector Insertion
Chr 7: 116855695 - 116856050
Public Clones CMHD-GT_399G11-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106735
Sequence
GCGGCTTTGGGCAGGGGTAGACCCTAACAAGCTCTAGGCGGCAGCTGCTGCCTCTGAAGAAGTCCACAAATGGGATGATCCTGAGTCCTGTAGGTGACCA

GGTTAGGAGGGGAGTTGGTGGCTTCTGCTGGGGGTCAGTTGGTCAGGGCAGGGTGTGTAAAGAGAATGAGCATGCTCCAAGGAGTCCCAGCCACTGGGGA

GGAGGAAGGAGGTAACACCAACGGGAGCCGAGCTGCCAGGTATTTCCGTGGCTCATCTTTGGAGACTTAACAGTGAGCGTGCAGGTTCTGAAGGAGGATT

AAAGAGGGCTCTCTAAGCTCCTAGCTTAAGTTCTTCAGCCCTCCCTAGTCCCCCAGGGACATTCTAAG GTGGGCGCGCTGAAGGTCATGCAGCCCTCTG

CCAGTCCTGGGCTGCCACTGCCCAAATACTGCAGTGTGGCCACAACCGTGAAAGCCCCTGACCTGCATGGTGCTGTGCCGCCCTGGGACATGTCCTTCAC

CTGTCCCTTTGCCACGCAAGCACCCTGGCTGGCCACGCACTGCACATTCACCAG GTGCACTGCCTGTTGCCCATGTCTTCACACTGTTGATCGGCCATG

GCCGGGGCTCCGCTGGCTGGGAAGAGTCGGAGCTGCGGGCGGCTCCTGGGTCCTGGCCAGAAAGGAACCGGATGGCTTTTATTATCTGGCTCAGATAAAG

GCTGCTCCAGAG CTGGAGAAGCGGGGGGCCCTGGTTGTGGAATTTGAGGCTCCCCTTGTCACAGGCCTAGAGCTGCCAGCCCAGCAGCAGAGGGTGGTA

TTTCCAGAGGATGTTATTCAGTTTTCACCATCTGTGCCACACTCACTGCAGCTGGGTGACAAGGTGTTGGCACCCTGGGAACCGGGGCAGCAGCGGTATG

GCCCCGGCACTGTTCTAGTGGGCTTGAAGAAGCAAAAAGGACAAAGAG CATCTAAAGAAAAAGAAATCACTGTTCATTTCTGGAATGGCAAGACAACTA

AGGTGCCTCTAGGCAGCGTCAGGTGGGTGCCCCCCACGGTCTGGAAGAAGGCTGTGGAAAGACTACAAGCACCTCATACCAGGGACTGCCACAGTTCTTG

TCTCTGGGTACCTCACTGCTCTCAGCTGGGACCCCGTGCTGGATGCACCACACACAGGCATCCTCTGGACTCTTCCTTCTTATGCCCTCCCTGCCTCTCC

TGTGCCTGCTGCCAGCTTCAGTGCCAGAGCAGCTGCCCTTTGGTGGGGCCGAGCTGGTGGCCTCTAACTAGGACTTCAGAGCTCACAACCAGAAAACTCC

CGGAGCCAGAGGTGAAGCCCACAGCTCAGCTTTTGCCCCTACAAGGTCCTAAGGAGGAGCCGGTGGCAGAGCTCAGCTACAATATGTTCTCCTCCTCCTC

CTCCTCTTCCGAGGAAGAAAATTCAGAGAGTCATCTGGAGATGGGGCTGCCTCTGAGACAGATGGTAAGCAGGGCAGTCAACACTGACCCCATCCTTTCT

GAGACGACATCTCTGCAGCAGTACAGCCCCCACAAGCCCGAGTGGAGGTACTGGAGGAGAAATGGGCCTGAACCACCGCCTGGAAAGCCAG - UNI303

98 - GACGTTAAAGGATCATGAGGTAAAACACTTGAAAAGGGCTTACAACGAGTAGTTGACAACGGAACTGGAGGAGGCTGAGCGGTGGCGGACAAGAG

TGCCTAAGAGCAGCTGCTCTCCTGAGACCTGAGGGGAGCGGCATTCAGAAGCACCTGTTGTGAGGGGCACAGAGCTGGTGGGCCTGTACTGAAACTCCCT

GCCAGTGGCCTGATGAACTGCTTAGGACACCTATTCATGGGAGGGACGGGTGTGCCCATTGCATTGGGCAAATGCATCCCATTTGTCTTCTCATAAAGCC

TACAATGTGGGAAACATTGTCTTTTTATCTTTTTAATAGCAATAAAATGAATTCTTTTT
Translation
 MQPSASPGLPLPKYCSVATTVKAPDLHGAVPPWDMSFTCPFATQAPWLATHCTFTR RCTACCPCLHTVDRPWPGLRWLGRVGAAGGSWVLARKEPDGF

YYLAQIKAAPE LEKRGALVVEFEAPLVTGLELPAQQQRVVFPEDVIQFSPSVPHSLQLGDKVLAPWEPGQQRYGPGTVLVGLKKQKGQRA ASKEKEIT

VHFWNGKTTKVPLGSVRWVPPTVWKKAVERLQAPHTRDCHSSCLWVPHCSQLGPRAGCTTHRHPLDSSFLCPPCLSCACCQLQCQSSCPLVGPSWWPLTR

TSELTTRKLPEPEVKPTAQLLPLQGPKEEPVAELSYNMFSSSSSSSEEENSESHLEMGLPLRQMVSRAVNTDPILSETTSLQQYSPHKPEWRYWRRNGPE

PPPGKPG - UNI30398 - GR
Transcript ENSMUST00000033334
Sequence
AGGTGGGACTGAGACTGGGGCAAGGCTGAGGTCTAGACTGGATTTGCACTTTTAG GTGGGCGCGCTGAAGGTCATGCAGCCCTCTGCCAGTCCTGGGCT

GCCACTGCCCAAATACTGCAGTGTGGCCACAACCGTGAAAGCCCCTGACCTGCATGGTGCTGTGCCGCCCTGGGACATGTCCTTCACCTGTCCCTTTGCC

ACGCAAGCACCCTGGCTGGCCACGCACTGCACATTCACCAG GTGCACTGCCTGTTGCCCATGTCTTCACACTGTTGATCGGCCATGGCCGGGGCTCCGC

TGGCTGGGAAGAGTCGGAGCTGCGGGCGGCTCCTGGGTCCTGGCCAGAAAGGAACCGGATGGCTTTTATTATCTGGCTCAGATAAAGGCTGCTCCAGAG 

CTGGAGAAGCGGGGGGCCCTGGTTGTGGAATTTGAGGCTCCCCTTGTCACAGGCCTAGAGCTGCCAGCCCAGCAGCAGAGGGTGGTATTTCCAGAGGATG

TTATTCAGTTTTCACCATCTGTGCCACACTCACTGCAGCTGGGTGACAAGGTGTTGGCACCCTGGGAACCGGGGCAGCAGCGGTATGGCCCCGGCACTGT

TCTAGTGGGCTTGAAGAAGCAAAAAGGACAAAGAG CATCTAAAGAAAAAGAAATCACTGTTCATTTCTGGAATGGCAAGACAACTAAGGTGCCTCTAGG

CAGCGTCAGGTGGGTGCCCCCCACGGTCTGGAAGAAGGCTGTGGAAAGACTACAAGCACCTCATACCAGGGACTGCCACAGTTCTTGTCTCTGGGTACCT

CACTGCTCTCAGCTGGGACCCCGTGCTGGATGCACCACACACAGGCATCCTCTGGACTCTTCCTTCTTATGCCCTCCCTGCCTCTCCTGTGCCTGCTGCC

AGCTTCAGTGCCAGAGCAGCTGCCCTTTGGTGGGGCCGAGCTGGTGGCCTCTAACTAGGACTTCAGAGCTCACAACCAGAAAACTCCCGGAGCCAGAGGT

GAAGCCCACAGCTCAGCTTTTGCCCCTACAAGGTCCTAAGGAGGAGCCGGTGGCAGAGCTCAGCTACAATATGTTCTCCTCCTCCTCCTCCTCTTCCGAG

GAAGAAAATTCAGAGAGTCATCTGGAGATGGGGCTGCCTCTGAGACAGATGGTAAGCAGGGCAGTCAACACTGACCCCATCCTTTCTGAGACGACATCTC

TGCAGCAGTACAGCCCCCACAAGCCCGAGTGGAGGTACTGGAGGAGAAATGGGCCTGAACCACCGCCTGGAAAGCCAG - UNI30398 - GACGTTAA

AGGATCATGAGGTAAAACACTTGAAAAGGGCTTACAACGAGTAGTTGACAACGGAACTGGAGGAGGCTGAGCGGTGGCGGACAAGAGTGCCTAAGAGCAG

CTGCTCTCCTGAGACCTGAGGGGAGCGGCATTCAGAAGCACCTGTTGTGAGGGGCACAGAGCTGGTGGGCCTGTACTGAAACTCCCTGCCAGTGGCCTGA

TGAACTGCTTAGGACACCTATTCATGGGAGGGACGGGTGTGCCCATTGCATTGGGCAAATGCATCCCATTTGTCTTCTCATAAAGCCTACAATGTGGGAA

ACATTGTCTTTTTATCTTTTTAATAGCAATAAAATGAATTCTTT
Translation
 MQPSASPGLPLPKYCSVATTVKAPDLHGAVPPWDMSFTCPFATQAPWLATHCTFTR RCTACCPCLHTVDRPWPGLRWLGRVGAAGGSWVLARKEPDGF

YYLAQIKAAPE LEKRGALVVEFEAPLVTGLELPAQQQRVVFPEDVIQFSPSVPHSLQLGDKVLAPWEPGQQRYGPGTVLVGLKKQKGQRA ASKEKEIT

VHFWNGKTTKVPLGSVRWVPPTVWKKAVERLQAPHTRDCHSSCLWVPHCSQLGPRAGCTTHRHPLDSSFLCPPCLSCACCQLQCQSSCPLVGPSWWPLTR

TSELTTRKLPEPEVKPTAQLLPLQGPKEEPVAELSYNMFSSSSSSSEEENSESHLEMGLPLRQMVSRAVNTDPILSETTSLQQYSPHKPEWRYWRRNGPE

PPPGKPG - UNI30398 - GR

For any suggestions or comments, please send an email to unitrap@crg.es