Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031024 (St5)
Chromosomal location
Chr 7: 116667425 - 116760661 (-)
Description
suppression of tumorigenicity 5 Gene [Source:MGI Symbol;Acc:MGI:108517]
RefSeq_dna
NM_001001326 NM_029811 
RefSeq_peptide
NP_001001326.1 NP_084087.2 
UniGene
Mm.397872 Mm.407522 Mm.252009 
MGI
MGI:108517 
Uniprot/SWISSPROT
Q924W7 
Uniprot/SPTREMBL
Q3TYX0 
Human Ortholog
ENSG00000166444 (ST5)
Omim not available
UniTrap UNI16126
Vector Insertion
Chr 7: 116713626 - 116759811
Public Clones (sanger) D119E05 (ggtc) IST15069D12 (tigm) IST14569H11 (tigm) IST14560E5 (tigm)
IST14577A8 (tigm) IST14563G9 (tigm) IST14226B10 (tigm) IST10455E10 (tigm)
IST13574D7 (tigm) IST10040H11 (tigm) IST11406B3 (tigm) IST10054E9 (tigm)
IST14180F5 (tigm) IST14231A2 (tigm) IST14635E6 (tigm) IST14936B9 (tigm)
IST10040G11 (tigm) IST11927H5HMF1 (tigm) IST14335C2 (tigm) IST14288F9 (tigm)
Private Clones OST466279 (lexicon) OST345840 (lexicon) OST332667 (lexicon) OST318064 (lexicon)
OST303688 (lexicon) OST302770 (lexicon) OST292153 (lexicon) OST279503 (lexicon)
OST250607 (lexicon) OST246082 (lexicon) OST240000 (lexicon) OST236649 (lexicon)
OST222649 (lexicon) OST205200 (lexicon) OST191580 (lexicon) OST191354 (lexicon)
OST189935 (lexicon) OST186778 (lexicon) OST184011 (lexicon) OST179561 (lexicon)
OST149119 (lexicon) OST138205 (lexicon) OST137056 (lexicon) OST134012 (lexicon)
OST87317 (lexicon) OST73067 (lexicon) OST68137 (lexicon) OST65715 (lexicon)
OST62527 (lexicon) OST59119 (lexicon) OST52726 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5972
Vector Insertion
Chr 7: 116683951 - 116684849
Public Clones CSH363 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29288
Vector Insertion
Chr 7: 116671306 - 116674595
Public Clones not available
Private Clones OST611 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9942
Vector Insertion
Chr 7: 116668195 - 116668776
Public Clones XD046 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28450
Vector Insertion
Chr 7: 116667424 - 116668195
Public Clones not available
Private Clones OST30690 (lexicon)
Severity of mutation (?) Insertion after 99% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079282
Sequence
GAAGACAAGAGACTGCTTGGGCTCTGGCACTAGTACCATGGGACCCTGTACTGGCTAAAAGCTGTCTCCAGGACCTGAACAGTCAACAAG - UNI1612

6 - GGCTCTGGGTTTGCAGAGAGCCGAAATGACCATGACTGCCAACAAGAACTCCAGCATCACTCATGGAACCGGAGGCACTAAGGCCCCTCGGGAGAC

GCTGAGCAG GTCTCAGTCAGTCTCTCCACCTCCAGTTTTATACCCACCAAGAAGTCCCATCTACCCACTCAGTGACAGTGAAACCTCAGCCTGCAGGTA

CCCCAGCCACTCTAAATCCCAGGTGCTCCTCAAGGACCGGCATTCTCGAAATCCTTCACTCCTAGGTCAAGATCCGTCCCCAGAAACCTCACCACCCATT

TGTACCCTCAAGGCTACCAGCTTCAGCTATTTGGACAGAACCCCTTCATTACGCAAAAGAGAGGACCAGAAGGAGACTGTCCAGGGTGCAGTCCAGGATG

TAGAAGGTGTGGCTGCTTGCCTCCCCCTTGCCCAGAGCACCCCATTCCTAGGGGCCGGGTCTCGGAGTGTCTTGCTGAGTTGCACTGGTACCCGAGCCCA

TAGCCTGGGTATCCGAGAGAAGATCTCAGCATGGGAAGGTCGCCGAGAGGCTTCACCCAGGATGAGTCTGTGTGGAGAGAAGCGGGAGGGCCCTGGGAGC

GAGTGGTCGGTCAGTGAGGGCTGCCCCAGTGTGGGCTGCCCCAGTGTGGTGCCATCCCCCTGCAGCTCAGAAAAGACCTTTGATTTCAAAGGCCTCCGGA

GGATGAGCAGGACCTTCTCTGAGTGTTCCTACCCCGAGACAGAGGAGGAGGCAGAGGCACTTCCTGGACGGGACTCTTTATACCGGCTGGAGAAGCGTCC

AGGCCGGACTGAGCCCAGTGCCTTGCTCAGGGGGCATGGCATCAGGAAAGAGAGCTCAGCAGTGCTGAGCCGGATCCAGAAGATCGAACAAGCCCTAAAG

GAGCAGCCTGGCCGGGGTCTCCCCCAGCTCCCTAGCAGCTGCTACAGTGTAGACCAAGGGAGGAGGAAGACTGGAACTTTGGGCACCTTGGAGGAGCCAA

CAGGAACTGCAAGTGTAAGCCCCAGCAGCAGGGCAGGAGGAGTGGCCGGAGTTGCTGGGGAGGCAGGCCCACCCCTGGACAGGGAAGGCAGTGCTTCCAT

GAAGTCAGAGACCCCTGGAAATAGCTCCAGTCCCCAGCTGCTGCCTCCGAAGAGCTCCCCTGATCCAGCTGTGAACCCTGTTCCCAAACCCAAGCGTACC

TTTGAGTACGAGGCTGACAAGAATCCTAAGACTAAGCCAAGCAATGGTCTACCTCCTTCACCCACACCTGCTGCTCCACCCCCCTTGCCTTCCACCCCAG

CCCCACCAGTCACCCGGAGACCCAAGAAGGACATGCGTGGTCACCGGAAGTCACAGAACAG AAAATCCTTCGAGTTTGAGGATGCATCCAGTCTCCAAT

CCCTGTATCCCTCTTCTCCTACTGAGAATGGTACTGAGAGTCAACCCAAGTTTGGATCCAAAAGCACTTTAGAAGAGAATGCCTATGAAGATATTGTGG 

GAGGGCTTCCCAAGGAGAATCCCTACGAGGATGTGGACTTAAAGAACCGGAGAGCTGGACGAAAATCCCAGCAACTGTCTGAGAACTCCTTGGACTCTTT

GCACAGGATGTGGAGTCCCCAAGACAGGAAGTACAACCACCCACCCATGCAG CTGTCCCTGAAGTCCAACAGCCAGTCCCTGCGCAGTGGGAACTGGTC

AGAAAGGAAGAGCCATCGTTTGCCACGATTACCCAAGAGGCATAGCCATGATGACATGATGCTGTTGGCTCAGCTGAGCCTGCCATCTTCACCCTCCAGC

CTCAATGAGGACAGCCTCAGCACCACAAGTGAGCTGCTGTCCAGCCGCAGGTCCCGCCGCATTCCCAAG CTTGTCCAAAGAATTAACTCTATCTATAAT

GCCAAGAGAGGAAAGAAGAGGTTGAAAAAGCTGTCTATGTCCAGCCTTGAGACAGCATCATTGAGAG - UNI5972 - ATGAGAACAGTGAAAGCGAG

AGTGACTCTGATGACAGGTTCAAAG CCCACACCCAGCGCTTGGTCCACATCCAGTCGATGCTGAAGCGAGCGCCCAGCTATCGGACGCTGGAGCTGGAG

CTGCTCGAGTGGCAGGAGCGGGAGCTTTTTGAGTACTTTGTGGTTGTGTCCCTCAAGAAGAAGCCATCTCGGAACACCTACCTCCCTGAAGTCTCCTATC

AGTTTCCCAAG CTGGACCGTCCCACCAAACAGATGCGGGAGGCAGAAGAAAGGCTCAAAGCTATCCCCCAGTTTTGCTTTCCGGATGCCAAGGACTGGC

TCCCTGTGTCAGAATACAGCAG TGAAACCTTTTCTTTCATGCTGACTGGGGAAGATGGCAGCAGGCGCTTTGGCTATTGTAGGCGCTTACTG CCAAGT

GGGAAAGGGCCTCGGTTGCCAGAGGTGTACTGTGTCATCAGCCGCCTAGGCTGCTTCGGTTTGTTTTCCAAG GTCCTAGATGAGGTGGAGCGCCGGCGT

GGGATCTCAGCTGCACTGGTCTACCCCTTCATGAGAAGTCTCATGGAATCGCCCTTTCCAGCCCCAGGGAAAACCATCAAAGTGAAGACATTTCTTCCCG

GCGCTGGCAATGAG GTGTTAGAGCTGCGTCGGCCTATGGACTCCCGCCTGGAGCACGTGGACTTTGAGTGCCTCTTCACCTGCCTCAGTGTGCGTCAGC

TTATCCGAATCTTTGCCTCATTGCTGTTGGAACGCAGAGTCATTTTTGTAGCAGATAAGCTCAG - UNI29288 - TACCCTGTCCAGCTGCTCTCAC

GCGGTGGTGGCCTTGCTCTACCCCTTCTCCTGGCAGCACACATTCATTCCTGTCCTCCCAGCCTCCATGATTGACATTGTCTGCTGTCCCACCCCTTTCC

TGGTTGGCCTGCTCTCCAGCTCCCTTCCCAAACTGAAGGAGCTGCCTGTGGAAGAG GCACTGATGGTGAATCTGGGATCTGACCGATTCATCCGACAG 

ATGGACGACGAGGACACACTGTTACCTAGAAAGTTGCAAGCTGCTCTGGAGCAGGCTCTGGAGAGGAAGAGTGAGCTCATCTCCCAGGACTCTGACAGTG

ACTCTGATGATG AATGTAATACCCTCAATGGACTTGTGTCAGAGGTGTTTATCCGGTTCTTTGTGGAGACTGTGGGTCACTACTCCCTCTTCCTGACAC

ACAGTGAGAAGGGGGAAAGGGCTTTTCAGCGAGAGGCCTTCCGCAAGTCTGTGGCCTCCAAAAGTATCCGCCGTTTTCTTGAAGTTTTTATGGAATCTCA

GATGTTTGCTGGCTTCATCCAAGACAGGGAGCTAAGGAAGTGTCGAGCCAAGG GCCTCTTTGAGCAGAGAGTGGAACAGTATCTAGAAGAGCTCCCTGA

CACTGAGCAGAGCGGGATGAACAAGTTTCTCCGGGGCCTGG - UNI9942 - - UNI28450 - GCAACAAGATGAAGTTCCTCCACAAGAAGAATT

AAATGCCTTTCCTGGTAGCAGAGTTTAGTGCTTTGCAGAGCCCAGGGAGAGGGCCCAGCCTGGGACCCTGTGGGCTGCTGTGGCTACTTTGCTTCTACAG

GCCCCACTCCAAGCCAGCCCACTTCTGCCTTCACCATATTCCAGGATACTGTTTGTAAATAATCTGCTGTAAGCTTTCCTGTTTTTGTAACAAGCAAAGA

AAATCTGGTAAATATTTGTATATTCCCAAAGGGCCAGGTGCTTTCTTGCCTTGTCTGAGCTTGGATGGAGTCTTGCTGGGTGCTGGTGACTGGCCAATTA

TGTGCAGCTGACTGTCTCAGCCAAACCACTCATGTTTCCTCAAGACTTCTGGCCTGTCTGCCTGAGGCCCTGCTGCCAGTCTTGGGCCCTGGAGAGCAGG

TGCTGTCTTAATTATGTATAAGAGGACTGGTTTTTTTTTTGTTTTTGTTTTTTTGGTTGTTTTTAAATCTAGAGTTTCTAATTTTTTCTTCTTAGTAGTT

CCCCTATCTGCCAAGCCTCTTGTTTCTGAAAGGCAAGGATCACTTCGCCCTTTTTTGCAATGTAGAGCCAGGCACTTGGGCCTGGTCCTTGTTCCTTCCA

TCCTCTGACATGGTCAGTGAGTCATGGGAAGCGGAGCTCCCGTCAGTCAGTGGTGGCCATGATGCGGTACAGGGCATTTCTCCTTCCACCATCCACAGAT

GTTCTCAATAAACTGTACATTCATTTTGGCTGAAGAG
Translation
 - UNI16126 - MTMTANKNSSITHGTGGTKAPRETLSR RSQSVSPPPVLYPPRSPIYPLSDSETSACRYPSHSKSQVLLKDRHSRNPSLLGQDPSP

ETSPPICTLKATSFSYLDRTPSLRKREDQKETVQGAVQDVEGVAACLPLAQSTPFLGAGSRSVLLSCTGTRAHSLGIREKISAWEGRREASPRMSLCGEK

REGPGSEWSVSEGCPSVGCPSVVPSPCSSEKTFDFKGLRRMSRTFSECSYPETEEEAEALPGRDSLYRLEKRPGRTEPSALLRGHGIRKESSAVLSRIQK

IEQALKEQPGRGLPQLPSSCYSVDQGRRKTGTLGTLEEPTGTASVSPSSRAGGVAGVAGEAGPPLDREGSASMKSETPGNSSSPQLLPPKSSPDPAVNPV

PKPKRTFEYEADKNPKTKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKKDMRGHRKSQNR RKSFEFEDASSLQSLYPSSPTENGTESQPKFGSKSTLEE

NAYEDIVG GGLPKENPYEDVDLKNRRAGRKSQQLSENSLDSLHRMWSPQDRKYNHPPMQ LSLKSNSQSLRSGNWSERKSHRLPRLPKRHSHDDMMLLA

QLSLPSSPSSLNEDSLSTTSELLSSRRSRRIPK LVQRINSIYNAKRGKKRLKKLSMSSLETASLRD - UNI5972 - DENSESESDSDDRFKA AHT

QRLVHIQSMLKRAPSYRTLELELLEWQERELFEYFVVVSLKKKPSRNTYLPEVSYQFPK LDRPTKQMREAEERLKAIPQFCFPDAKDWLPVSEYSS SE

TFSFMLTGEDGSRRFGYCRRLL PSGKGPRLPEVYCVISRLGCFGLFSK VLDEVERRRGISAALVYPFMRSLMESPFPAPGKTIKVKTFLPGAGNE VL

ELRRPMDSRLEHVDFECLFTCLSVRQLIRIFASLLLERRVIFVADKLS - UNI29288 - STLSSCSHAVVALLYPFSWQHTFIPVLPASMIDIVCCP

TPFLVGLLSSSLPKLKELPVEE ALMVNLGSDRFIRQ MDDEDTLLPRKLQAALEQALERKSELISQDSDSDSDDE ECNTLNGLVSEVFIRFFVETVGH

YSLFLTHSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKG GLFEQRVEQYLEELPDTEQSGMNKFLRGLG - UNI9942 

- - UNI28450 - GNKMKFLHKKN
Transcript ENSMUST00000077909
Sequence
GCGCCTAGCTGAGTGAGAGCAAGCCTGCAAGCGTGTGTGCAGCCTAGGACAGGTCTCCATGACAACCAGCCTGACTGGCTAGCTGCGCTAGCTCTGCTCA

CTTGGCTGGAAGGAGTGTCTTGAAAGGTCAGAGGAAGGAGCTGTGGGAAGTTCGCAGCAGGTACTGGAGCTTAAGCCAGTGGATCTGGGGGCCCTGGGCT

CCCTAAGCGACTGTGGTGTGAGCCAGCCTCTGTGGAGAATGGAGTGGGCAAGAAATCACCCGGACTACCAG - UNI16126 - GGCTCTGGGTTTGCA

GAGAGCCGAAATGACCATGACTGCCAACAAGAACTCCAGCATCACTCATGGAACCGGAGGCACTAAGGCCCCTCGGGAGACGCTGAGCAG GTCTCAGTC

AGTCTCTCCACCTCCAGTTTTATACCCACCAAGAAGTCCCATCTACCCACTCAGTGACAGTGAAACCTCAGCCTGCAGGTACCCCAGCCACTCTAAATCC

CAGGTGCTCCTCAAGGACCGGCATTCTCGAAATCCTTCACTCCTAGGTCAAGATCCGTCCCCAGAAACCTCACCACCCATTTGTACCCTCAAGGCTACCA

GCTTCAGCTATTTGGACAGAACCCCTTCATTACGCAAAAGAGAGGACCAGAAGGAGACTGTCCAGGGTGCAGTCCAGGATGTAGAAGGTGTGGCTGCTTG

CCTCCCCCTTGCCCAGAGCACCCCATTCCTAGGGGCCGGGTCTCGGAGTGTCTTGCTGAGTTGCACTGGTACCCGAGCCCATAGCCTGGGTATCCGAGAG

AAGATCTCAGCATGGGAAGGTCGCCGAGAGGCTTCACCCAGGATGAGTCTGTGTGGAGAGAAGCGGGAGGGCCCTGGGAGCGAGTGGTCGGTCAGTGAGG

GCTGCCCCAGTGTGGGCTGCCCCAGTGTGGTGCCATCCCCCTGCAGCTCAGAAAAGACCTTTGATTTCAAAGGCCTCCGGAGGATGAGCAGGACCTTCTC

TGAGTGTTCCTACCCCGAGACAGAGGAGGAGGCAGAGGCACTTCCTGGACGGGACTCTTTATACCGGCTGGAGAAGCGTCCAGGCCGGACTGAGCCCAGT

GCCTTGCTCAGGGGGCATGGCATCAGGAAAGAGAGCTCAGCAGTGCTGAGCCGGATCCAGAAGATCGAACAAGCCCTAAAGGAGCAGCCTGGCCGGGGTC

TCCCCCAGCTCCCTAGCAGCTGCTACAGTGTAGACCAAGGGAGGAGGAAGACTGGAACTTTGGGCACCTTGGAGGAGCCAACAGGAACTGCAAGTGTAAG

CCCCAGCAGCAGGGCAGGAGGAGTGGCCGGAGTTGCTGGGGAGGCAGGCCCACCCCTGGACAGGGAAGGCAGTGCTTCCATGAAGTCAGAGACCCCTGGA

AATAGCTCCAGTCCCCAGCTGCTGCCTCCGAAGAGCTCCCCTGATCCAGCTGTGAACCCTGTTCCCAAACCCAAGCGTACCTTTGAGTACGAGGCTGACA

AGAATCCTAAGACTAAGCCAAGCAATGGTCTACCTCCTTCACCCACACCTGCTGCTCCACCCCCCTTGCCTTCCACCCCAGCCCCACCAGTCACCCGGAG

ACCCAAGAAGGACATGCGTGGTCACCGGAAGTCACAGAACAG AAAATCCTTCGAGTTTGAGGATGCATCCAGTCTCCAATCCCTGTATCCCTCTTCTCC

TACTGAGAATGGTACTGAGAGTCAACCCAAGTTTGGATCCAAAAGCACTTTAGAAGAGAATGCCTATGAAGATATTGTGG GAGGGCTTCCCAAGGAGAA

TCCCTACGAGGATGTGGACTTAAAGAACCGGAGAGCTGGACGAAAATCCCAGCAACTGTCTGAGAACTCCTTGGACTCTTTGCACAGGATGTGGAGTCCC

CAAGACAGGAAGTACAACCACCCACCCATGCAG CTGTCCCTGAAGTCCAACAGCCAGTCCCTGCGCAGTGGGAACTGGTCAGAAAGGAAGAGCCATCGT

TTGCCACGATTACCCAAGAGGCATAGCCATGATGACATGATGCTGTTGGCTCAGCTGAGCCTGCCATCTTCACCCTCCAGCCTCAATGAGGACAGCCTCA

GCACCACAAGTGAGCTGCTGTCCAGCCGCAGGTCCCGCCGCATTCCCAAG CTTGTCCAAAGAATTAACTCTATCTATAATGCCAAGAGAGGAAAGAAGA

GGTTGAAAAAGCTGTCTATGTCCAGCCTTGAGACAGCATCATTGAGAG - UNI5972 - ATGAGAACAGTGAAAGCGAGAGTGACTCTGATGACAGGT

TCAAAG CCCACACCCAGCGCTTGGTCCACATCCAGTCGATGCTGAAGCGAGCGCCCAGCTATCGGACGCTGGAGCTGGAGCTGCTCGAGTGGCAGGAGC

GGGAGCTTTTTGAGTACTTTGTGGTTGTGTCCCTCAAGAAGAAGCCATCTCGGAACACCTACCTCCCTGAAGTCTCCTATCAGTTTCCCAAG CTGGACC

GTCCCACCAAACAGATGCGGGAGGCAGAAGAAAGGCTCAAAGCTATCCCCCAGTTTTGCTTTCCGGATGCCAAGGACTGGCTCCCTGTGTCAGAATACAG

CAG TGAAACCTTTTCTTTCATGCTGACTGGGGAAGATGGCAGCAGGCGCTTTGGCTATTGTAGGCGCTTACTG CCAAGTGGGAAAGGGCCTCGGTTGC

CAGAGGTGTACTGTGTCATCAGCCGCCTAGGCTGCTTCGGTTTGTTTTCCAAG GTCCTAGATGAGGTGGAGCGCCGGCGTGGGATCTCAGCTGCACTGG

TCTACCCCTTCATGAGAAGTCTCATGGAATCGCCCTTTCCAGCCCCAGGGAAAACCATCAAAGTGAAGACATTTCTTCCCGGCGCTGGCAATGAG GTGT

TAGAGCTGCGTCGGCCTATGGACTCCCGCCTGGAGCACGTGGACTTTGAGTGCCTCTTCACCTGCCTCAGTGTGCGTCAGCTTATCCGAATCTTTGCCTC

ATTGCTGTTGGAACGCAGAGTCATTTTTGTAGCAGATAAGCTCAG - UNI29288 - TACCCTGTCCAGCTGCTCTCACGCGGTGGTGGCCTTGCTCT

ACCCCTTCTCCTGGCAGCACACATTCATTCCTGTCCTCCCAGCCTCCATGATTGACATTGTCTGCTGTCCCACCCCTTTCCTGGTTGGCCTGCTCTCCAG

CTCCCTTCCCAAACTGAAGGAGCTGCCTGTGGAAGAG GCACTGATGGTGAATCTGGGATCTGACCGATTCATCCGACAG ATGGACGACGAGGACACAC

TGTTACCTAGAAAGTTGCAAGCTGCTCTGGAGCAGGCTCTGGAGAGGAAGAGTGAGCTCATCTCCCAGGACTCTGACAGTGACTCTGATGATG AATGTA

ATACCCTCAATGGACTTGTGTCAGAGGTGTTTATCCGGTTCTTTGTGGAGACTGTGGGTCACTACTCCCTCTTCCTGACACACAGTGAGAAGGGGGAAAG

GGCTTTTCAGCGAGAGGCCTTCCGCAAGTCTGTGGCCTCCAAAAGTATCCGCCGTTTTCTTGAAGTTTTTATGGAATCTCAGATGTTTGCTGGCTTCATC

CAAGACAGGGAGCTAAGGAAGTGTCGAGCCAAGG GCCTCTTTGAGCAGAGAGTGGAACAGTATCTAGAAGAGCTCCCTGACACTGAGCAGAGCGGGATG

AACAAGTTTCTCCGGGGCCTGG - UNI9942 - - UNI28450 - GCAACAAGATGAAGTTCCTCCACAAGAAGAATTAAATGCCTTTCCTGGTAGC

AGAGTTTAGTGCTTTGCAGAGCCCAGGGAGAGGGCCCAGCCTGGGACCCTGTGGGCTGCTGTGGCTACTTTGCTTCTACAGGCCCCACTCCAAGCCAGCC

CACTTCTGCCTTCACCATATTCCAGGATACTGTTTGTAAATAATCTGCTGTAAGCTTTCCTGTTTTTGTAACAAGCAAAGAAAATCTGGTAAATATTTGT

ATATTCCCAAAGGGCCAGGTGCTTTCTTGCCTTGTCTGAGCTTGGATGGAGTCTTGCTGGGTGCTGGTGACTGGCCAATTATGTGCAGCTGACTGTCTCA

GCCAAACCACTCATGTTTCCTCAAGACTTCTGGCCTGTCTGCCTGAGGCCCTGCTGCCAGTCTTGGGCCCTGGAGAGCAGGTGCTGTCTTAATTATGTAT

AAGAGGACTGGTTTTTTTTTTGTTTTTGTTTTTTTGGTTGTTTTTAAATCTAGAGTTTCTAATTTTTTCTTCTTAGTAGTTCCCCTATCTGCCAAGCCTC

TTGTTTCTGAAAGGCAAGGATCACTTCGCCCTTTTTTGCAATGTAGAGCCAGGCACTTGGGCCTGGTCCTTGTTCCTTCCATCCTCTGACATGGTCAGTG

AGTCATGGGAAGCGGAGCTCCCGTCAGTCAGTGGTGGCCATGATGCGGTACAGGGCATTTCTCCTTCCACCATCCACAGATGTTCTCAATAAACTGTACA

TTCATTTTG
Translation
 - UNI16126 - MTMTANKNSSITHGTGGTKAPRETLSR RSQSVSPPPVLYPPRSPIYPLSDSETSACRYPSHSKSQVLLKDRHSRNPSLLGQDPSP

ETSPPICTLKATSFSYLDRTPSLRKREDQKETVQGAVQDVEGVAACLPLAQSTPFLGAGSRSVLLSCTGTRAHSLGIREKISAWEGRREASPRMSLCGEK

REGPGSEWSVSEGCPSVGCPSVVPSPCSSEKTFDFKGLRRMSRTFSECSYPETEEEAEALPGRDSLYRLEKRPGRTEPSALLRGHGIRKESSAVLSRIQK

IEQALKEQPGRGLPQLPSSCYSVDQGRRKTGTLGTLEEPTGTASVSPSSRAGGVAGVAGEAGPPLDREGSASMKSETPGNSSSPQLLPPKSSPDPAVNPV

PKPKRTFEYEADKNPKTKPSNGLPPSPTPAAPPPLPSTPAPPVTRRPKKDMRGHRKSQNR RKSFEFEDASSLQSLYPSSPTENGTESQPKFGSKSTLEE

NAYEDIVG GGLPKENPYEDVDLKNRRAGRKSQQLSENSLDSLHRMWSPQDRKYNHPPMQ LSLKSNSQSLRSGNWSERKSHRLPRLPKRHSHDDMMLLA

QLSLPSSPSSLNEDSLSTTSELLSSRRSRRIPK LVQRINSIYNAKRGKKRLKKLSMSSLETASLRD - UNI5972 - DENSESESDSDDRFKA AHT

QRLVHIQSMLKRAPSYRTLELELLEWQERELFEYFVVVSLKKKPSRNTYLPEVSYQFPK LDRPTKQMREAEERLKAIPQFCFPDAKDWLPVSEYSS SE

TFSFMLTGEDGSRRFGYCRRLL PSGKGPRLPEVYCVISRLGCFGLFSK VLDEVERRRGISAALVYPFMRSLMESPFPAPGKTIKVKTFLPGAGNE VL

ELRRPMDSRLEHVDFECLFTCLSVRQLIRIFASLLLERRVIFVADKLS - UNI29288 - STLSSCSHAVVALLYPFSWQHTFIPVLPASMIDIVCCP

TPFLVGLLSSSLPKLKELPVEE ALMVNLGSDRFIRQ MDDEDTLLPRKLQAALEQALERKSELISQDSDSDSDDE ECNTLNGLVSEVFIRFFVETVGH

YSLFLTHSEKGERAFQREAFRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKG GLFEQRVEQYLEELPDTEQSGMNKFLRGLG - UNI9942 

- - UNI28450 - GNKMKFLHKKN
Transcript ENSMUST00000084738
Sequence
GCGCCTAGCTGAGTGAGAGCAAGCCTGCAAGCGTGTGTGCAGCCTAGGACAGGTCTCCATGACAACCAGCCTGACTGGCTAGCTGCGCTAGCTCTGCTCA

CTTGGCTGGAAGGAGTGTCTTGAAAGGTCAGAGGAAGGAGCTGTGGGAAGTTCGCAGCAGGTACTGGAGCTTAAGCCAGTGGATCTGGGGGCCCTGGGCT

CCCTAAGCGACTGTGGTGTGAGCCAGCCTCTGTGGAGAATGGAGTGGGCAAGAAATCACCCGGACTACCAG - UNI16126 - GGCTCTGGGTTTGCA

GAGAGCCGAAATGACCATGACTGCCAACAAGAACTCCAGCATCACTCATGGAACCGGAGGCACTAAGGCCCCTCGGGAGACGCTGAGCAG AAAATCCTT

CGAGTTTGAGGATGCATCCAGTCTCCAATCCCTGTATCCCTCTTCTCCTACTGAGAATGGTACTGAGAGTCAACCCAAGTTTGGATCCAAAAGCACTTTA

GAAGAGAATGCCTATGAAGATATTGTGG GAGGGCTTCCCAAGGAGAATCCCTACGAGGATGTGGACTTAAAGAACCGGAGAGCTGGACGAAAATCCCAG

CAACTGTCTGAGAACTCCTTGGACTCTTTGCACAGGATGTGGAGTCCCCAAGACAGGAAGTACAACCACCCACCCATGCAG CTGTCCCTGAAGTCCAAC

AGCCAGTCCCTGCGCAGTGGGAACTGGTCAGAAAGGAAGAGCCATCGTTTGCCACGATTACCCAAGAGGCATAGCCATGATGACATGATGCTGTTGGCTC

AGCTGAGCCTGCCATCTTCACCCTCCAGCCTCAATGAGGACAGCCTCAGCACCACAAGTGAGCTGCTGTCCAGCCGCAGGTCCCGCCGCATTCCCAAG C

TTGTCCAAAGAATTAACTCTATCTATAATGCCAAGAGAGGAAAGAAGAGGTTGAAAAAGCTGTCTATGTCCAGCCTTGAGACAGCATCATTGAGAG - U

NI5972 - ATGAGAACAGTGAAAGCGAGAGTGACTCTGATGACAGGTTCAAAG CCCACACCCAGCGCTTGGTCCACATCCAGTCGATGCTGAAGCGAG

CGCCCAGCTATCGGACGCTGGAGCTGGAGCTGCTCGAGTGGCAGGAGCGGGAGCTTTTTGAGTACTTTGTGGTTGTGTCCCTCAAGAAGAAGCCATCTCG

GAACACCTACCTCCCTGAAGTCTCCTATCAGTTTCCCAAG CTGGACCGTCCCACCAAACAGATGCGGGAGGCAGAAGAAAGGCTCAAAGCTATCCCCCA

GTTTTGCTTTCCGGATGCCAAGGACTGGCTCCCTGTGTCAGAATACAGCAG TGAAACCTTTTCTTTCATGCTGACTGGGGAAGATGGCAGCAGGCGCTT

TGGCTATTGTAGGCGCTTACTG CCAAGTGGGAAAGGGCCTCGGTTGCCAGAGGTGTACTGTGTCATCAGCCGCCTAGGCTGCTTCGGTTTGTTTTCCAA

G GTCCTAGATGAGGTGGAGCGCCGGCGTGGGATCTCAGCTGCACTGGTCTACCCCTTCATGAGAAGTCTCATGGAATCGCCCTTTCCAGCCCCAGGGAA

AACCATCAAAGTGAAGACATTTCTTCCCGGCGCTGGCAATGAG GTGTTAGAGCTGCGTCGGCCTATGGACTCCCGCCTGGAGCACGTGGACTTTGAGTG

CCTCTTCACCTGCCTCAGTGTGCGTCAGCTTATCCGAATCTTTGCCTCATTGCTGTTGGAACGCAGAGTCATTTTTGTAGCAGATAAGCTCAG - UNI2

9288 - TACCCTGTCCAGCTGCTCTCACGCGGTGGTGGCCTTGCTCTACCCCTTCTCCTGGCAGCACACATTCATTCCTGTCCTCCCAGCCTCCATGAT

TGACATTGTCTGCTGTCCCACCCCTTTCCTGGTTGGCCTGCTCTCCAGCTCCCTTCCCAAACTGAAGGAGCTGCCTGTGGAAGAG GCACTGATGGTGAA

TCTGGGATCTGACCGATTCATCCGACAG ATGGACGACGAGGACACACTGTTACCTAGAAAGTTGCAAGCTGCTCTGGAGCAGGCTCTGGAGAGGAAGAG

TGAGCTCATCTCCCAGGACTCTGACAGTGACTCTGATGATG AATGTAATACCCTCAATGGACTTGTGTCAGAGGTGTTTATCCGGTTCTTTGTGGAGAC

TGTGGGTCACTACTCCCTCTTCCTGACACACAGTGAGAAGGGGGAAAGGGCTTTTCAGCGAGAGGCCTTCCGCAAGTCTGTGGCCTCCAAAAGTATCCGC

CGTTTTCTTGAAGTTTTTATGGAATCTCAGATGTTTGCTGGCTTCATCCAAGACAGGGAGCTAAGGAAGTGTCGAGCCAAGG GCCTCTTTGAGCAGAGA

GTGGAACAGTATCTAGAAGAGCTCCCTGACACTGAGCAGAGCGGGATGAACAAGTTTCTCCGGGGCCTGG - UNI9942 - - UNI28450 - GCAA

CAAGATGAAGTTCCTCCACAAGAAGAATTAAATGCCTTTCCTGGTAGCAGAGTTTAGTGCTTTGCAGAGCCCAGGGAGAGGGCCCAGCCTGGGACCCTGT

GGGCTGCTGTGGCTACTTTGCTTCTACAGGCCCCACTCCAAGCCAGCCCACTTCTGCCTTCACCATATTCCAGGATACTGTTTGTAAATAATCTGCTGTA

AGCTTTCCTGTTTTTGTAACAAGCAAAGAAAATCTGGTAAATATTTGTATATTCCCAAAGGGCCAGGTGCTTTCTTGCCTTGTCTGAGCTTGGATGGAGT

CTTGCTGGGTGCTGGTGACTGGCCAATTATGTGCAGCTGACTGTCTCAGCCAAACCACTCATGTTTCCTCAAGACTTCTGGCCTGTCTGCCTGAGGCCCT

GCTGCCAGTCTTGGGCCCTGGAGAGCAGGTGCTGTCTTAATTATGTATAAGAGGACTGGTTTTTTTTTTGTTTTTGTTTTTTTGGTTGTTTTTAAATCTA

GAGTTTCTAATTTTTTCTTCTTAGTAGTTCCCCTATCTGCCAAGCCTCTTGTTTCTGAAAGGCAAGGATCACTTCGCCCTTTTTTGCAATGTAGAGCCAG

GCACTTGGGCCTGGTCCTTGTTCCTTCCATCCTCTGACATGGTCAGTGAGTCATGGGAAGCGGAGCTCCCGTCAGTCAGTGGTGGCCATGATGCGGTACA

GGGCATTTCTCCTTCCACCATCCACAGATGTTCTCAATAAACTGTACATTCATTTTG
Translation
 - UNI16126 - MTMTANKNSSITHGTGGTKAPRETLSR RKSFEFEDASSLQSLYPSSPTENGTESQPKFGSKSTLEENAYEDIVG GGLPKENPYE

DVDLKNRRAGRKSQQLSENSLDSLHRMWSPQDRKYNHPPMQ LSLKSNSQSLRSGNWSERKSHRLPRLPKRHSHDDMMLLAQLSLPSSPSSLNEDSLSTT

SELLSSRRSRRIPK LVQRINSIYNAKRGKKRLKKLSMSSLETASLRD - UNI5972 - DENSESESDSDDRFKA AHTQRLVHIQSMLKRAPSYRTL

ELELLEWQERELFEYFVVVSLKKKPSRNTYLPEVSYQFPK LDRPTKQMREAEERLKAIPQFCFPDAKDWLPVSEYSS SETFSFMLTGEDGSRRFGYCR

RLL PSGKGPRLPEVYCVISRLGCFGLFSK VLDEVERRRGISAALVYPFMRSLMESPFPAPGKTIKVKTFLPGAGNE VLELRRPMDSRLEHVDFECLF

TCLSVRQLIRIFASLLLERRVIFVADKLS - UNI29288 - STLSSCSHAVVALLYPFSWQHTFIPVLPASMIDIVCCPTPFLVGLLSSSLPKLKELP

VEE ALMVNLGSDRFIRQ MDDEDTLLPRKLQAALEQALERKSELISQDSDSDSDDE ECNTLNGLVSEVFIRFFVETVGHYSLFLTHSEKGERAFQREA

FRKSVASKSIRRFLEVFMESQMFAGFIQDRELRKCRAKG GLFEQRVEQYLEELPDTEQSGMNKFLRGLG - UNI9942 - - UNI28450 - GNKM

KFLHKKN

For any suggestions or comments, please send an email to unitrap@crg.es