Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031065 (Pctk1)
Chromosomal location
Chr X: 20265080 - 20277006 (+)
Description
PCTAIRE-motif protein kinase 1 Gene [Source:MGI (curated);Acc:Pctk1-002]
RefSeq_dna
NM_011049 
RefSeq_peptide
NP_035179.1 
UniGene
Mm.102574 Mm.392081 Mm.411044 
MGI
MGI:97516 
Uniprot/SWISSPROT
Q04735 
Uniprot/SPTREMBL
Q3TM24 Q3UPI3 Q543G3 Q91WP4 
Human Ortholog
ENSG00000102225 (PCTK1)
Omim not available
UniTrap UNI27634
Vector Insertion
Chr X: 20265933 - 20270449
Public Clones not available
Private Clones OST54942 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115364
Sequence
GGTAGAGGGTGGGTGGCAGGGCGGGGCTAGATTGTCCTAGCTAAGGTGGTAATCCAGGCCACCTCTCCTAGAAAGTCATTTCCAGCCTTTAAATTCTTGC

CTCCCGAGGCACCACAAAGGACTGGAACTGCTTCGCTCACCTGTTCTTTTTCTCCTTGCAAAAGTCCCGTTTACCACCATGGGGATGTACCAAATGAGAC

TGTAGGGAAAGAAGGTGGTGACTGGCACGCCTGGCTACTGGCTGCTGCTCACCTCGATGCTAGTAAATTTCTAGCAAGATCAAAACTATTAACCCCTCTC

TAAATCCCCCTGGCGCCGTTCCAGGGCCAACGCCACATTCCCTGCTGGGCACGCAATGGCCGCACCCCCTCCCGCTGCAGAAGGCTCTTTTGGTACACGC

AGTCCGAG - UNI27634 - GTCGCCATGGATCGGATGAAGAAGATCAAACGGCAGCTGTCAATGACACTCCGAGGGGGCCGAGGCATAGATAAGACC

AATGGTGTCCCTGAGCAGATAGGCCTGGATGAGAGTGGTGGCGGTGGTGGCAGTGACCTTGGAGAAGCTCCCACCCGTATTGCCCCTGGGGAGCTTCGCT

CTGTTCGGGGCCCACTCAGCTCTGCACCAG GTCTACCTGGGTTTCCCAGTCTGCTCTAGGGGCCATGTACACAAATGGATACGATGAAGAAATATATTA

TATTGGGGGAAAGAGAGTGTTCTTGACTCCAAAGGCCTGGCCTTTCCCTCTCCCCACCCCAGAGATTGTGCACGAGGACATGAAGATGGGATCTGATGGG

GAGAGTGACCAGGCTTCAGCCACATCCTCAGATGAGGTGCAGTCTCCAGTGAGAGTGCGCATGCGCAACCACCCCCCACGCAAGATCTCCACTGAG GAC

ATCAACAAACGCCTGTCACTACCAGCTGACATACGGCTGCCTGAGGGCTACCTTGAGAAGCTGACCCTCAATAGCCCCATCTTTGATAAGCCTCTTAGCC

GGCGCCTCCGCCGAGTCAGTTTG TCTGAGATTGGCTTTGGAAAACTGGAGACCTACATCAAGCTAGACAAGCTGGGTGAG GGTACCTATGCCACTGTC

TACAAAGGCAAAAGCAAGCTCACAGACAACCTTGTAGCACTTAAGGAGATCAGACTGGAACACGAAGAAGGGGCACCCTGTACTGCTATCCGGGAAG TA

TCCCTGCTTAAGGACCTCAAGCATGCCAACATCGTCACACTACATGACATTATCCACACAGAGAAGTCCCTCACACTTGTCTTTGAATACTTG GACAAG

GACCTGAAGCAGTACCTGGATGACTGTGGAAATGTCATCAACATGCACAATGTGAAA CTGTTCCTGTTCCAGTTGCTCCGTGGCCTGGCCTACTGCCAC

AGGCAGAAGGTGCTACACCGAGACCTCAAGCCCCAGAACCTACTCATCAACGAGAGGGGAGAGCTCAAACTGGCAGATTTTG GCCTGGCTCGTGCCAAG

TCAATTCCTACTAAAACATACTCCAACGAAGTGGTGACACTGTGGTACCGGCCCCCTGACATCCTACTTGGGTCCACAGACTACTCTACCCAAATTGACA

TGTG GGGTGTAGGCTGCATCTTCTATGAGATGGCCACCGGCCGGCCCCTCTTCCCAGGCTCCACAGTGGAAGAACAGCTGCACTTCATCTTCCGCATTT

TGG GAACCCCAACTGAGGAGACATGGCCAGGTATCCTGTCCAATGAGGAGTTTAGAACATACAACTACCCCAAGTACCGAGCCGAGGCCCTTCTGAGCC

ATGCACCCCG ACTTGATAGCGATGGAGCTGACCTCCTCACCAAGCTGCTGCAG TTTGAGGGTCGCAATCGGATCTCTGCTGAGGATGCCAGGAAACAT

CCATTCTTTCTCAGCTTGGGGGAGCGGATCCACAAACTTCCTGACA CTACTTCCATATTTGCACTAAAGGAGGTACAGCTACAAAAGGAGGCCAACATT

CGGTCCACTTCTATGCCTGACTCAG GCAGGCCAGCTTTCCGTGTGGTGGATACCGAGTTCTAAGCCAAGTTTTAAGCCACAGACAGACCAAGGCCCCAG

CAGGCAGCGGCTGGAGGGATGCCACACCCCTTACAGGGCAGCCCCCATCTGCAATCCTCCCTGCTTGTTGCCTGCTTACCTGCCTGAGCCACACTCCCCT

GCCAACTTGTCCCCTGCCACCTGCCCAAACACCAAACCACTGGCCTGGCCTGTCAACCCAACCATTGGCCTGTCTGCTGGGTGCTAACAAAGCTCTCACC

ACTACTTTGCTTGATGTGTCTGTCTCTGTCTTGGTAGTTGCTGGTGAACAGAATGGCCATGCCAGGTTTCCACACTAAGGCTAGGCCTTCCCCTCTAAAT

CACACTCTCTCCCAGGACCACTACCCCATGGCCAGCCAGGGATTTGGAGCTAGCCCAGGCCAGGCTCTTAATTGACTTTGACTAGAAGGTAGTGAGTGAT

GCCTTGGGTCTGAGCATCCTCTGCCTGCTTGCCACCTGTCCCACTTGCCTCTGTTGTATGGGCCTTCTTTTTTGTTAGTTTCTTTTATTGTTTTTTTATT

ATTTTAAATGAGGTTCTCACTTTTTAATGCAATATCTCTGTATACAGACTGGTTGGGCGCTACTCCCTGAGTATGGCCCTCCTACAGTATTTTGTGCAAT

GAAGTCCCACTCCCAGCCTTTGAGAGGTAGGGACCCAGACCCTATTCAGATCCTGACCATCACTATACCCTGGGATTGGCTATGGGAAAGCATGCCTCAG

CCACTCACCTTCCTCCCCTACCTAGTGTCCCCAGCTATAGGGGGACCTGAGAACTACCAGAGACTGGGAGATGGACATGGTGGGGGCTACTTTTTCCCTC

CTTTAGTCCCGTAGCCAGGGCCTCTTTCCTTCTCAGGGTCTTCCCCAGCCCAGCTCTGCCTAGCCCTCCTGTCCTGTCCTACTCGGTGCTGTTGAGTAGG

GGCTCTGCCAGGAATTGACCAGCTTAGTGAGGAGCCATATATAATATGTGCACAAGCAGGGGGACATGTGCGAGCTTGTGCCCAATTGTAACACTCCAGT

CCCTAGGAGGGTAAGGCAGGCCAAGGACAGTCTCCTGGATGTATGGTTTGCTCCCCTTCCTCCACCTTAAGCCTTGGGACCCTTAAGCGGGGTGGGAGGG

CAAGGGAGGGTGCCCTCCTAGTGGGGTTTGGGGGGATTGGGTTCCTGAATGCACCATAATTGCTGTATGAAATATTAAAAAAAAGTCTAAAGTTCAAA
Translation
 - UNI27634 -  MYTNGYDEEIYYIGGKRVFLTPKAWPFPLPTPEIVHEDMKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTE DINKRLS

LPADIRLPEGYLEKLTLNSPIFDKPLSRRLRRVSL SEIGFGKLETYIKLDKLGE GTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREV VSLL

KDLKHANIVTLHDIIHTEKSLTLVFEYL DKDLKQYLDDCGNVINMHNVK LFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFG GLARAK

SIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMW WGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILG GTPTEETWPGILSNEEFRTYNYPKYRAEA

LLSHAPR RLDSDGADLLTKLLQ FEGRNRISAEDARKHPFFLSLGERIHKLPDT TTSIFALKEVQLQKEANIRSTSMPDSG GRPAFRVVDTEF
Transcript ENSMUST00000033380
Sequence
CGGCTGTTGGGCCGCTGGCTGGGGGGCTCTGGGATATGCTGCGTCTCCGCTAGCTGTCTGCTGTGAGTCACGAGCCGCCGTGAACACCCGGATTCCAGCG

GGCGCTTGCGAGCACGGGGGCATCGCCCGCAGTGGCCAAGCTCATGGCCGGCTGAGCGGGACGCCGCCGCCGCCTCAGCCGCCGCCGCCGCCGCCGCCTC

TTCCTCCTCAGCCGGCGGCGGCCCGGGCCCAGCAGCCATGGCCGAAGACTACTGGGACGGGCGCCTGCGGCGAACTGGAGGAAAAGGAGGTCGCGCGGCC

TCATCCCGGGCCGCCGCCCCAGGCGCCACCGCGCCGGCCCCGCGGCTCTGAGGTTACTCGCGCGCCCCCTCCG - UNI27634 - GTCGCCATGGATC

GGATGAAGAAGATCAAACGGCAGCTGTCAATGACACTCCGAGGGGGCCGAGGCATAGATAAGACCAATGGTGTCCCTGAGCAGATAGGCCTGGATGAGAG

TGGTGGCGGTGGTGGCAGTGACCTTGGAGAAGCTCCCACCCGTATTGCCCCTGGGGAGCTTCGCTCTGTTCGGGGCCCACTCAGCTCTGCACCAG AGAT

TGTGCACGAGGACATGAAGATGGGATCTGATGGGGAGAGTGACCAGGCTTCAGCCACATCCTCAGATGAGGTGCAGTCTCCAGTGAGAGTGCGCATGCGC

AACCACCCCCCACGCAAGATCTCCACTGAG GACATCAACAAACGCCTGTCACTACCAGCTGACATACGGCTGCCTGAGGGCTACCTTGAGAAGCTGACC

CTCAATAGCCCCATCTTTGATAAGCCTCTTAGCCGGCGCCTCCGCCGAGTCAGTTTG TCTGAGATTGGCTTTGGAAAACTGGAGACCTACATCAAGCTA

GACAAGCTGGGTGAG GGTACCTATGCCACTGTCTACAAAGGCAAAAGCAAGCTCACAGACAACCTTGTAGCACTTAAGGAGATCAGACTGGAACACGAA

GAAGGGGCACCCTGTACTGCTATCCGGGAAG TATCCCTGCTTAAGGACCTCAAGCATGCCAACATCGTCACACTACATGACATTATCCACACAGAGAAG

TCCCTCACACTTGTCTTTGAATACTTG GACAAGGACCTGAAGCAGTACCTGGATGACTGTGGAAATGTCATCAACATGCACAATGTGAAA CTGTTCCT

GTTCCAGTTGCTCCGTGGCCTGGCCTACTGCCACAGGCAGAAGGTGCTACACCGAGACCTCAAGCCCCAGAACCTACTCATCAACGAGAGGGGAGAGCTC

AAACTGGCAGATTTTG GCCTGGCTCGTGCCAAGTCAATTCCTACTAAAACATACTCCAACGAAGTGGTGACACTGTGGTACCGGCCCCCTGACATCCTA

CTTGGGTCCACAGACTACTCTACCCAAATTGACATGTG GGGTGTAGGCTGCATCTTCTATGAGATGGCCACCGGCCGGCCCCTCTTCCCAGGCTCCACA

GTGGAAGAACAGCTGCACTTCATCTTCCGCATTTTGG GAACCCCAACTGAGGAGACATGGCCAGGTATCCTGTCCAATGAGGAGTTTAGAACATACAAC

TACCCCAAGTACCGAGCCGAGGCCCTTCTGAGCCATGCACCCCG ACTTGATAGCGATGGAGCTGACCTCCTCACCAAGCTGCTGCAG TTTGAGGGTCG

CAATCGGATCTCTGCTGAGGATGCCAGGAAACATCCATTCTTTCTCAGCTTGGGGGAGCGGATCCACAAACTTCCTGACA CTACTTCCATATTTGCACT

AAAGGAGGTACAGCTACAAAAGGAGGCCAACATTCGGTCCACTTCTATGCCTGACTCAG GCAGGCCAGCTTTCCGTGTGGTGGATACCGAGTTCTAAGC

CAAGTTTTAAGCCACAGACAGACCAAGGCCCCAGCAGGCAGCGGCTGGAGGGATGCCACACCCCTTACAGGGCAGCCCCCATCTGCAATCCTCCCTGCTT

GTTGCCTGCTTACCTGCCTGAGCCACACTCCCCTGCCAACTTGTCCCCTGCCACCTGCCCAAACACCAAACCACTGGCCTGGCCTGTCAACCCAACCATT

GGCCTGTCTGCTGGGTGCTAACAAAGCTCTCACCACT
Translation
 - UNI27634 - MDRMKKIKRQLSMTLRGGRGIDKTNGVPEQIGLDESGGGGGSDLGEAPTRIAPGELRSVRGPLSSAPE EIVHEDMKMGSDGESDQ

ASATSSDEVQSPVRVRMRNHPPRKISTE DINKRLSLPADIRLPEGYLEKLTLNSPIFDKPLSRRLRRVSL SEIGFGKLETYIKLDKLGE GTYATVYK

GKSKLTDNLVALKEIRLEHEEGAPCTAIREV VSLLKDLKHANIVTLHDIIHTEKSLTLVFEYL DKDLKQYLDDCGNVINMHNVK LFLFQLLRGLAYC

HRQKVLHRDLKPQNLLINERGELKLADFG GLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMW WGVGCIFYEMATGRPLFPGSTVEEQLHF

IFRILG GTPTEETWPGILSNEEFRTYNYPKYRAEALLSHAPR RLDSDGADLLTKLLQ FEGRNRISAEDARKHPFFLSLGERIHKLPDT TTSIFALK

EVQLQKEANIRSTSMPDSG GRPAFRVVDTEF

For any suggestions or comments, please send an email to unitrap@crg.es