Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031075 (Tmem16a)
Chromosomal location
Chr 7: 151774454 - 151924461 (-)
Description
anoctamin 1, calcium activated chloride channel Gene [Source:MGI (curated);Acc:Tmem16a-001]
RefSeq_dna
NM_178642 
RefSeq_peptide
NP_848757.3 
UniGene
Mm.26700 Mm.437507 
MGI
MGI:2142149 
Uniprot/SWISSPROT
Q8BHY3 
Human Ortholog
ENSG00000131620 (ANO1)
Omim not available
UniTrap UNI14239
Vector Insertion
Chr 7: 151864538 - 151924384
Public Clones FHCRC-GT-S23-4B1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30749
Vector Insertion
Chr 7: 151805379 - 151807656
Public Clones IST10241F11 (tigm) IST14845D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 47% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18890
Vector Insertion
Chr 7: 151800830 - 151804753
Public Clones not available
Private Clones OST412238 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033393
Sequence
CTCTGCCGGTCCCTCTGCTGGACCCAGGGCGTCCGGAGCGAACACATCATGCAGGACGCGCAGGACAGCGACATCGGCCTGGAGGGCTTGACCCCAGAGG

GAACCTCTGCGGACCGAGAGTGCCAGCGGGGACCGGAAACAATCGCGCACGAGGCACAGGACGCAGGAACCCCCAACTCAG - UNI14239 - ACGCC

ACCGGGGTTGTGGATGGGGAGCGCGAGGCCACCATGAGGGTCCCCGAGAAGTACTCGACGCTCCCGGCGGAGGACCGCAGCGTCCACATCGTGAACATCT

GCGCCATCGAGGACCTGGGCTACCTGCCGTCCGAGGGCACG - UNI14239 - TTGCTGAACTCTCTGTCCGTGGACCCCGACGCCGAATGCAAGTAT

GGACTATACTTCAGGGATGGCAAACGGAAGGTGGACTACATCTTGGTATACCATCACAAGAGAGCCTCAGGGAGCAGGACTCTGGCCAGGAGGGGACTAC

AAAATGACATGGTCCTGGGGACCCGCAGCGTCAGGCAGGACCAGCCCCTTCCCGGGAAGGGGAGCCCTGTGGATGCAGGCTCACCGGAAGTCCCCATGGA

TTACCATGAAGATGACAAACGCTTCAGACGGGAGGAATATGAGGGCAACCTGTTGGAGGCAGGCCTGGAGTTGGAGAATGACGAGGAT ACCAAAATCCA

TGGTGTCGGGTTTGTGAAGATCCATGCGCCCTGGCATGTGCTCTGTAGGGAAGCTGAGTTTTTGAAACTAAAGATGCCCACAAAGAAG GTGTACCACAT

CAGTGAGACGCGAGGCCTCCTGAAAACCATCAACTCGGTTCTGCAGAAGATCACAGACCCCATCCAGCCCAAGGTGGCTGAGCACAGGCCACAGACCACA

AAGAGGCTCTCCTATCCCTTCTCCCGGGAGAAGCAACACCT ATTCGACCTGACTGACAGGGACTCTTTTTTCGACAGCAAAACCCGGAGCACAATA GT

CTATGAAATCCTGAAGAGAACAACGTGCACCAAGGCCAAGTACAGCATGG GTATCACCAGCCTCCTGGCCAATGGCGTATACTCAGCTGCATACCCTCT

GCACGAT GGGGACTATGAGGGTGACAACGTTGAGTTCAACGACAGGAAA CTCCTGTATGAGGAATGGGCAAGTTACGGAGTCTTCTACAAATACCAGC

CCATTGACCTGGTCAG GAAATACTTTGGTGAGAAGGTTGGCCTGTACTTTGCCTGGCTTGGAGCCTACACCCAGATGCTCATCCCTGCCTCGATCGTGG

GTGTCATTGTCTTTCTCTATGGATGTGCCACTGTGGACGAAAACATCCCCAG TATGGAGATGTGTGACCAGAGATACAACATCACCATGTGTCCTCTGT

GTGACAAGACCTGCAGCTACTGGAAGATGAGCTCAGCCTGTGCCACAGCCCGTGCCAGTCACCTTTTTGATAACCCTGCCACCGTCTTCTTCTCTGTGTT

TATGGCCCTCTGGG - UNI30749 - CTGCCACTTTCATGGAGCACTGGAAACGGAAGCAGATGAGGCTCAACTACCGATGGGACCTCACAGGCTTCG

AGGAGGAGGAG - UNI30749 - GATCATCCCAGAGCAGAGTATGAAGCCAGAGTCTTAGAGAAGTCACTGAGAAAAGAATCCAGAAACAAAGAG - 

UNI18890 - ACCGACAAGGTGAAGCTGACCTGGAGGGACCGATTCCCAGCCTATTTCACCAATCTTGTCTCCATCATCTTCATG ATCGCAGTGACAT

TTGCAATCGTCCTCGGAGTTATCATCTATAGAATCTCCACAGCTGCAGCCTTGGCCATGAACTCCTCCCCGTCTGTGCGGTCCAACATCCGGGTTACAGT

CACGGCCACCGCTGTTATCATCAACCTCGTGGTCATCATTCTGCTGGATGAAGTTTACGGCTGCATTGCCAGGTGGCTCACCAAGATTG AGGTCCCAAA

GACAGAGAAGAGCTTTGAGGAGAGGCTAACCTTCAAGGCCTTCCTGCTCAAGTTTGTGAACTCTTACACTCCCATCTTCTATGTCGCCTTCTTCAAAGGC

CG GTTTGTTGGTCGGCCCGGTGACTACGTGTACATCTTCCGCTCTTTCCGGATGGAGGAG TGTGCCCCGGGCGGCTGCCTCATGGAGCTCTGTATCCA

GCTGAGCATCATTATGCTGGGCAAGCAGCTAATCCAGAACAATCTCTTCGAGATTGGCATCCC GAAGATGAAAAAGTTCATCCGCTACCTGAAGCTGCG

CAGACAGAGCCCCTCAGACCGTGAAGAGTACGTGAAGCGGAAGCAGCGCTATGAGGTGGACTTCAACCTCGAACCTTTCGCCGGCCTCACGCCCGAGTAC

ATGGAAATGA TCATTCAGTTCGGCTTTGTCACCCTGTTTGTTGCGTCCTTCCCTCTGGCTCCACTCTTCGCCCTGCTAAACAACATCATTGAGATCCGC

CTGGATGCCAAAAAGTTTGTCACCGAGCTACGGAGGCCAGTAGCCATCAGAGCCAAAGACATCG GCATCTGGTATAACATCCTCAGAGGTGTTGGGAAG

CTGGCTGTCATCATTAAT GCCTTTGTGATCTCCTTCACGTCTGACTTCATCCCTCGCCTGGTGTACCTCTACATGTACAGTCAGAATGGGACCATGCAC

GGCTTCGTCAATCACACGCTCTCTTCCTTCAATGTCAGCGACTTCCAGAATGGCACAGCACCCAATGACCCACTGGACCTGGGCTATGAGGTTCAGATCT

GCAG GTATAAAGATTACCGGGAACCCCCATGGTCAGAACACAAGTATGACATCTCCAAAGACTTCTGGGCTGTCCTGGCCGCCCGACTGGCATTTGTCA

TTGTCTTCCAG AACCTGGTGATGTTCATGAGTGACTTTGTGGACTGGGTGATCCCTGATATCCCCAAAGACATCAGCCAGCAGATCCACAAAGAGAAGG

TTCTCATGGTGGAGCTGTTTATGCGTGAGGAGCAGGGCAAGCAGCAGCTACTGGACACATGGATGGAGAAGGAGAAGCCAAGGGATGTGCCTTGTAACAA

CCACAGCCCCACAACCCACCCAGAGGCAGGCGACGGCAGCCCAGTCCCCAGCTACGAGTACCATGGGGACGCGCTGTAGCCATGATGACAGGCCAGCAGG

CCAGCAGGCTTCTGACCATCACCAAGTGACTACTCGGCTTCCTCCAAAGCCAGCACTTCTAGCCCCACCAGGGCCTATGGCTCTTGTGTCGTCTGGACGT

GTGGAGGAGCACTCTGATGAGACAACGGTCTTCTTTCTTCTTTCTGTTTCTTCTCATTTTTGCACAAGGCCATTATGCAGGGAAGTTTTTATCTTTAGTA

TTCAATGCCAAGGATGGCTGGTGATGGGGATGAACAGGGTGAGGCATGTTCCACAGACATATGGAGGAATATAGAGCCCCCCTGTGGTGGTAGGGAGCCA

AGTCAGCATCCTTAGTCTGAAGGATGCCCTGGGATAGATGCAGAATGGTACCTAGGAACCTGCTGACATTTTGCAGAAGGGTGAACAACTCAGACTCAGA

TTCCCAAAGATGTCACCTGCTCTAGCTGGACAAGCTGGAAGACTCCACTGTCTTTCCTTCTGGGAGCTCAGAAGTTCAGACCTGGGGTCAGAAACAGAGG

TGCCTGACCACCCACACAGCACACACATATGGTGGCTTCACATTGTACTCCAGTAACGGAGGAGTACAGGGGCTCCCAGTTGTCCAGTACCCTTGGGGTC

CCTGGCAGGCTGCACACAAGCCACTCAAGGGCCCCTCACATGAAGCTGATGTCCTCCTTGTGAGACAAGCTGTCGTGACAAGCAGGGCATCTCTAAACAG

GCTGGAGGGCTTCACCAAGCCCTGGGACCTCTGTGGGTTCATTTTTTTTTGCTTTTTAAACCATCTATTGGTTTTTGTCTAAAAATCAATAATGTGATGG

ATTTGAGGGATTTTCTTTCTGTAGCTGAAGGTGGAAGGAGTTTATTTCATTAGTTAACCAAATACTGAGAGGAAATTAAAATATCATTACTACCAAAGAT

TTTTCTCAATAAAAGCTTCTATTTTGGTAACACACCTATATTTTCACTCGTGGGGATGAGACCCTCAGCACTTACCATTGTAATAGCTTCTAAAACAAGC

CTCATGGGCCAGCTTCATTTGATGTGCTAGCCAGCTGTACAAGGCCTCTCGGCACCATTGCCAGAAGTGTCTCTCTCGCCCAAGCCGAAGAAGGCAATTC

CCTGCACTCGTCTTAGGGCAAGGCAGACAGTGCTGTAGTTGTGAGCTGGGGTCCGAATCTCAGGCTTCCAAGGTTTGCACTGTTTGCTAAAATCGTGAGA

CCTGATGCTTCTATTTTCTCTTGTGCAGTGATGTGGTTTCCAATGATGTTTTGTATATAGCTACTGTATCCAAAATTAGATAATTACCAAAAATTCTTTT

ACAGAAACCATTTTT
Translation
 - UNI14239 - MRVPEKYSTLPAEDRSVHIVNICAIEDLGYLPSEGT - UNI14239 - LLNSLSVDPDAECKYGLYFRDGKRKVDYILVYHHKR

ASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDED TKIHGVGFVKIHAPWHVLCREAEF

LKLKMPTKK VYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYPFSREKQHL LFDLTDRDSFFDSKTRSTI VYEILKRTTCTKAKYSMG

 GITSLLANGVYSAAYPLHD GDYEGDNVEFNDRK LLYEEWASYGVFYKYQPIDLVR RKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVD

ENIPS SMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA - UNI30749 - AATFMEHWKRKQMRLNYRWDLTGFE

EEE - UNI30749 - DHPRAEYEARVLEKSLRKESRNKE - UNI18890 - TDKVKLTWRDRFPAYFTNLVSIIFM IAVTFAIVLGVIIYRISTA

AALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIE EVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGR RFVGRPGDYVY

IFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIP PKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMI IIQF

GFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIG GIWYNILRGVGKLAVIIN AFVISFTSDFIPRLVYLYMYSQNGTMHGFVNH

TLSSFNVSDFQNGTAPNDPLDLGYEVQICR RYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQ NLVMFMSDFVDWVIPDIPKDISQQIHKEKVLM

VELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL
Transcript ENSMUST00000118556
Sequence
ACCTTCCTCCCGCCTCTGCCGGTCCCTCTGCTGGACCCAGGGCGTCCGGAGCGAACACATCATGCAGGACGCGCAGGACAGCGACATCGGCCTGGAGGGC

TTGACCCCAGAGGGAACCTCTGCGGACCGAGAGTGCCAGCGGGGACCGGAAACAATCGCGCACGAGGCACAGGACGCAGGAACCCCCAACTCAGGTG - 

UNI14239 - ACGCCACCGGGGTTGTGGATGGGGAGCGCGAGGCCACCATGAGGGTCCCCGAGAAGTACTCGACGCTCCCGGCGGAGGACCGCAGCGTC

CACATCGTGAACATCTGCGCCATCGAGGACCTGGGCTACCTGCCGTCCGAGGGCACG - UNI14239 - TTGCTGAACTCTCTGTCCGTGGACCCCGA

CGCCGAATGCAAGTATGGACTATACTTCAGGGATGGCAAACGGAAGGTGGACTACATCTTGGTATACCATCACAAGAGAGCCTCAGGGAGCAGGACTCTG

GCCAGGAGGGGACTACAAAATGACATGGTCCTGGGGACCCGCAGCGTCAGGCAGGACCAGCCCCTTCCCGGGAAGGGGAGCCCTGTGGATGCAGGCTCAC

CGGAAGTCCCCATGGATTACCATGAAGATGACAAACGCTTCAGACGGGAGGAATATGAGGGCAACCTGTTGGAGGCAGGCCTGGAGTTGGAGAATGACGA

GGAT ACCAAAATCCATGGTGTCGGGTTTGTGAAGATCCATGCGCCCTGGCATGTGCTCTGTAGGGAAGCTGAGTTTTTGAAACTAAAGATGCCCACAAA

GAAG GTGTACCACATCAGTGAGACGCGAGGCCTCCTGAAAACCATCAACTCGGTTCTGCAGAAGATCACAGACCCCATCCAGCCCAAGGTGGCTGAGCA

CAGGCCACAGACCACAAAGAGGCTCTCCTATCCCTTCTCCCGGGAGAAGCAACACCT ATTCGACCTGACTGACAGGGACTCTTTTTTCGACAGCAAAAC

CCGGAGCACAATA GTCTATGAAATCCTGAAGAGAACAACGTGCACCAAGGCCAAGTACAGCATGG GTATCACCAGCCTCCTGGCCAATGGCGTATACT

CAGCTGCATACCCTCTGCACGAT GGGGACTATGAGGGTGACAACGTTGAGTTCAACGACAGGAAA CTCCTGTATGAGGAATGGGCAAGTTACGGAGTC

TTCTACAAATACCAGCCCATTGACCTGGTCAG GAAATACTTTGGTGAGAAGGTTGGCCTGTACTTTGCCTGGCTTGGAGCCTACACCCAGATGCTCATC

CCTGCCTCGATCGTGGGTGTCATTGTCTTTCTCTATGGATGTGCCACTGTGGACGAAAACATCCCCAG TATGGAGATGTGTGACCAGAGATACAACATC

ACCATGTGTCCTCTGTGTGACAAGACCTGCAGCTACTGGAAGATGAGCTCAGCCTGTGCCACAGCCCGTGCCAGTCACCTTTTTGATAACCCTGCCACCG

TCTTCTTCTCTGTGTTTATGGCCCTCTGGG - UNI30749 - CTGCCACTTTCATGGAGCACTGGAAACGGAAGCAGATGAGGCTCAACTACCGATGG

GACCTCACAGGCTTCGAGGAGGAGGAG - UNI30749 - GATCATCCCAGAGCAGAGTATGAAGCCAGAGTCTTAGAGAAGTCACTGAGAAAAGAATC

CAGAAACAAAGAG - UNI18890 - ACCGACAAGGTGAAGCTGACCTGGAGGGACCGATTCCCAGCCTATTTCACCAATCTTGTCTCCATCATCTTCA

TG ATCGCAGTGACATTTGCAATCGTCCTCGGAGTTATCATCTATAGAATCTCCACAGCTGCAGCCTTGGCCATGAACTCCTCCCCGTCTGTGCGGTCCA

ACATCCGGGTTACAGTCACGGCCACCGCTGTTATCATCAACCTCGTGGTCATCATTCTGCTGGATGAAGTTTACGGCTGCATTGCCAGGTGGCTCACCAA

GATTG AGGTCCCAAAGACAGAGAAGAGCTTTGAGGAGAGGCTAACCTTCAAGGCCTTCCTGCTCAAGTTTGTGAACTCTTACACTCCCATCTTCTATGT

CGCCTTCTTCAAAGGCCG GTTTGTTGGTCGGCCCGGTGACTACGTGTACATCTTCCGCTCTTTCCGGATGGAGGAG TGTGCCCCGGGCGGCTGCCTCA

TGGAGCTCTGTATCCAGCTGAGCATCATTATGCTGGGCAAGCAGCTAATCCAGAACAATCTCTTCGAGATTGGCATCCC GAAGATGAAAAAGTTCATCC

GCTACCTGAAGCTGCGCAGACAGAGCCCCTCAGACCGTGAAGAGTACGTGAAGCGGAAGCAGCGCTATGAGGTGGACTTCAACCTCGAACCTTTCGCCGG

CCTCACGCCCGAGTACATGGAAATGA TCATTCAGTTCGGCTTTGTCACCCTGTTTGTTGCGTCCTTCCCTCTGGCTCCACTCTTCGCCCTGCTAAACAA

CATCATTGAGATCCGCCTGGATGCCAAAAAGTTTGTCACCGAGCTACGGAGGCCAGTAGCCATCAGAGCCAAAGACATCG GCATCTGGTATAACATCCT

CAGAGGTGTTGGGAAGCTGGCTGTCATCATTAAT GCCTTTGTGATCTCCTTCACGTCTGACTTCATCCCTCGCCTGGTGTACCTCTACATGTACAGTCA

GAATGGGACCATGCACGGCTTCGTCAATCACACGCTCTCTTCCTTCAATGTCAGCGACTTCCAGAATGGCACAGCACCCAATGACCCACTGGACCTGGGC

TATGAGGTTCAGATCTGCAG GTATAAAGATTACCGGGAACCCCCATGGTCAGAACACAAGTATGACATCTCCAAAGACTTCTGGGCTGTCCTGGCCGCC

CGACTGGCATTTGTCATTGTCTTCCAG AACCTGGTGATGTTCATGAGTGACTTTGTGGACTGGGTGATCCCTGATATCCCCAAAGACATCAGCCAGCAG

ATCCACAAAGAGAAGGTTCTCATGGTGGAGCTGTTTATGCGTGAGGAGCAGGGCAAGCAGCAGCTACTGGACACATGGATGGAGAAGGAGAAGCCAAGGG

ATGTGCCTTGTAACAACCACAGCCCCACAACCCACCCAGAGGCAGGCGACGGCAGCCCAGTCCCCAGCTACGAGTACCATGGGGACGCGCTGTAGCCATG

ATGACAGGCCAGCAGGCCAGCAGGCTTCTGACCATCACCAAGTGACTACTCGGCTTCCTCCAAAGCCAGCACTTCTAGCCCCACCAGGGCCTATGGCTCT

TGTGTCGTCTGGACGTGTGGAGGAGCACTCTGATGAGACAACGGTCTTCTTTCTTCTTTCTGTTTCTTCTCATTTTTGCACAAGGCCATTATGCAGGGAA

GTTTTTATCTTTAGTATTCAATGCCAAGGATGGCTGGTGATGGGGATGAACAGGGTGAGGCATGTTCCACAGACATATGGAGGAATATAGAGCCCCCCTG

TGGTGGTAGGGAGCCAAGTCAGCATCCTTAGTCTGAAGGATGCCCTGGGATAGATGCAGAATGGTACCTAGGAACCTGCTGACATTTTGCAGAAGGGTGA

ACAACTCAGACTCAGATTCCCAAAGATGTCACCTGCTCTAGCTGGACAAGCTGGAAGACTCCACTGTCTTTCCTTCTGGGAGCTCAGAAGTTCAGACCTG

GGGTCAGAAACAGAGGTGCCTGACCACCCACACAGCACACACATATGGTGGCTTCACATTGTACTCCAGTAACGGAGGAGTACAGGGGCTCCCAGTTGTC

CAGTACCCTTGGGGTCCCTGGCAGGCTGCACACAAGCCACTCAAGGGCCCCTCACATGAAGCTGATGTCCTCCTTGTGAGACAAGCTGTCGTGACAAGCA

GGGCATCTCTAAACAGGCTGGAGGGCTTCACCAAGCCCTGGGACCTCTGTGGGTTCATTTTTTTTTGCTTTTTAAACCATCTATTGGTTTTTGTCTAAAA

ATCAATAATGTGATGGATTTGAGGGATTTTCTTTCTGTAGCTGAAGGTGGAAGGAGTTTATTTCATTAGTTAACCAAATACTGAGAGGAAATTAAAATAT

CATTACTACCAAAGATTTTTCTCAATAAAAGCTTCTATTTTGGTAACACACCTATATTTTCACTCGTGGGGATGAGACCCTCAGCACTTACCATTGTAAT

AGCTTCTAAAACAAGCCTCATGGGCCAGCTTCATTTGATGTGCTAGCCAGCTGTACAAGGCCTCTCGGCACCATTGCCAGAAGTGTCTCTCTCGCCCAAG

CCGAAGAAGGCAATTCCCTGCACTCGTCTTAGGGCAAGGCAGACAGTGCTGTAGTTGTGAGCTGGGGTCCGAATCTCAGGCTTCCAAGGTTTGCACTGTT

TGCTAAAATCGTGAGACCTGATGCTTCTATTTTCTCTTGTGCAGTGATGTGGTTTCCAATGATGTTTTGTATATAGCTACTGTATCCAAAATTAGATAAT

TACCAAAAATTCTTTTACAGAAACCATTTTTAAAAAACAACAAAAAAAACTAAAAAAAAAACAAAAAAACAAAACAAAACTGAATGTATACACACCCACA

GGAGACTGTGGCTGAGCGTTCATCCAAATAAATTTGAATACACAA
Translation
 - UNI14239 - MRVPEKYSTLPAEDRSVHIVNICAIEDLGYLPSEGT - UNI14239 - LLNSLSVDPDAECKYGLYFRDGKRKVDYILVYHHKR

ASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDED TKIHGVGFVKIHAPWHVLCREAEF

LKLKMPTKK VYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYPFSREKQHL LFDLTDRDSFFDSKTRSTI VYEILKRTTCTKAKYSMG

 GITSLLANGVYSAAYPLHD GDYEGDNVEFNDRK LLYEEWASYGVFYKYQPIDLVR RKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVD

ENIPS SMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA - UNI30749 - AATFMEHWKRKQMRLNYRWDLTGFE

EEE - UNI30749 - DHPRAEYEARVLEKSLRKESRNKE - UNI18890 - TDKVKLTWRDRFPAYFTNLVSIIFM IAVTFAIVLGVIIYRISTA

AALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIE EVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGR RFVGRPGDYVY

IFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIP PKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLEPFAGLTPEYMEMI IIQF

GFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIG GIWYNILRGVGKLAVIIN AFVISFTSDFIPRLVYLYMYSQNGTMHGFVNH

TLSSFNVSDFQNGTAPNDPLDLGYEVQICR RYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQ NLVMFMSDFVDWVIPDIPKDISQQIHKEKVLM

VELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL
Transcript ENSMUST00000121758
Sequence
CAGCGACATCGGCCTGGAGGGCTTGACCCCAGAGGGAACCTCTGCGGACCGAGAGTGCCAGCGGGGACCGGAAACAATCGCGCACGAGGCACAGGACGCA

GGAACCCCCAACTCAG - UNI14239 - ACGCCACCGGGGTTGTGGATGGGGAGCGCGAGGCCACCATGAGGGTCCCCGAGAAGTACTCGACGCTCCC

GGCGGAGGACCGCAGCGTCCACATCGTGAACATCTGCGCCATCGAGGACCTGGGCTACCTGCCGTCCGAGGGCACG - UNI14239 - TTGCTGAACT

CTCTGTCCGTGGACCCCGACGCCGAATGCAAGTATGGACTATACTTCAGGGATGGCAAACGGAAGGTGGACTACATCTTGGTATACCATCACAAGAGAGC

CTCAGGGAGCAGGACTCTGGCCAGGAGGGGACTACAAAATGACATGGTCCTGGGGACCCGCAGCGTCAGGCAGGACCAGCCCCTTCCCGGGAAGGGGAGC

CCTGTGGATGCAGGCTCACCGGAAGTCCCCATGGATTACCATGAAGATGACAAACGCTTCAGACGGGAGGAATATGAGGGCAACCTGTTGGAGGCAGGCC

TGGAGTTGGAGAATGACGAGGAT ACCAAAATCCATGGTGTCGGGTTTGTGAAGATCCATGCGCCCTGGCATGTGCTCTGTAGGGAAGCTGAGTTTTTGA

AACTAAAGATGCCCACAAAGAAG GTGTACCACATCAGTGAGACGCGAGGCCTCCTGAAAACCATCAACTCGGTTCTGCAGAAGATCACAGACCCCATCC

AGCCCAAGGTGGCTGAGCACAGGCCACAGACCACAAAGAGGCTCTCCTATCCCTTCTCCCGGGAGAAGCAACACCT ATTCGACCTGACTGACAGGGACT

CTTTTTTCGACAGCAAAACCCGGAGCACAATA GTCTATGAAATCCTGAAGAGAACAACGTGCACCAAGGCCAAGTACAGCATGG GTATCACCAGCCTC

CTGGCCAATGGCGTATACTCAGCTGCATACCCTCTGCACGAT GGGGACTATGAGGGTGACAACGTTGAGTTCAACGACAGGAAA CTCCTGTATGAGGA

ATGGGCAAGTTACGGAGTCTTCTACAAATACCAGCCCATTGACCTGGTCAG GAAATACTTTGGTGAGAAGGTTGGCCTGTACTTTGCCTGGCTTGGAGC

CTACACCCAGATGCTCATCCCTGCCTCGATCGTGGGTGTCATTGTCTTTCTCTATGGATGTGCCACTGTGGACGAAAACATCCCCAG TATGGAGATGTG

TGACCAGAGATACAACATCACCATGTGTCCTCTGTGTGACAAGACCTGCAGCTACTGGAAGATGAGCTCAGCCTGTGCCACAGCCCGTGCCAGTCACCTT

TTTGATAACCCTGCCACCGTCTTCTTCTCTGTGTTTATGGCCCTCTGGG - UNI30749 - CTGCCACTTTCATGGAGCACTGGAAACGGAAGCAGAT

GAGGCTCAACTACCGATGGGACCTCACAGGCTTCGAGGAGGAGGAG - UNI30749 - GAAGCTGTCAAG - UNI30749 - GATCATCCCAGAGC

AGAGTATGAAGCCAGAGTCTTAGAGAAGTCACTGAGAAAAGAATCCAGAAACAAAGAG - UNI18890 - ACCGACAAGGTGAAGCTGACCTGGAGGG

ACCGATTCCCAGCCTATTTCACCAATCTTGTCTCCATCATCTTCATG ATCGCAGTGACATTTGCAATCGTCCTCGGAGTTATCATCTATAGAATCTCCA

CAGCTGCAGCCTTGGCCATGAACTCCTCCCCGTCTGTGCGGTCCAACATCCGGGTTACAGTCACGGCCACCGCTGTTATCATCAACCTCGTGGTCATCAT

TCTGCTGGATGAAGTTTACGGCTGCATTGCCAGGTGGCTCACCAAGATTG AGGTCCCAAAGACAGAGAAGAGCTTTGAGGAGAGGCTAACCTTCAAGGC

CTTCCTGCTCAAGTTTGTGAACTCTTACACTCCCATCTTCTATGTCGCCTTCTTCAAAGGCCG GTTTGTTGGTCGGCCCGGTGACTACGTGTACATCTT

CCGCTCTTTCCGGATGGAGGAG TGTGCCCCGGGCGGCTGCCTCATGGAGCTCTGTATCCAGCTGAGCATCATTATGCTGGGCAAGCAGCTAATCCAGAA

CAATCTCTTCGAGATTGGCATCCC GAAGATGAAAAAGTTCATCCGCTACCTGAAGCTGCGCAGACAGAGCCCCTCAGACCGTGAAGAGTACGTGAAGCG

GAAGCAGCGCTATGAGGTGGACTTCAACCTCGAACCTTTCGCCGGCCTCACGCCCGAGTACATGGAAATGA TCATTCAGTTCGGCTTTGTCACCCTGTT

TGTTGCGTCCTTCCCTCTGGCTCCACTCTTCGCCCTGCTAAACAACATCATTGAGATCCGCCTGGATGCCAAAAAGTTTGTCACCGAGCTACGGAGGCCA

GTAGCCATCAGAGCCAAAGACATCG GCATCTGGTATAACATCCTCAGAGGTGTTGGGAAGCTGGCTGTCATCATTAAT GCCTTTGTGATCTCCTTCAC

GTCTGACTTCATCCCTCGCCTGGTGTACCTCTACATGTACAGTCAGAATGGGACCATGCACGGCTTCGTCAATCACACGCTCTCTTCCTTCAATGTCAGC

GACTTCCAGAATGGCACAGCACCCAATGACCCACTGGACCTGGGCTATGAGGTTCAGATCTGCAG GTATAAAGATTACCGGGAACCCCCATGGTCAGAA

CACAAGTATGACATCTCCAAAGACTTCTGGGCTGTCCTGGCCGCCCGACTGGCATTTGTCATTGTCTTCCAG AACCTGGTGATGTTCATGAGTGACTTT

GTGGACTGGGTGATCCCTGATATCCCCAAAGACATCAGCCAGCAGATCCACAAAGAGAAGGTTCTCATGGTGGAGCTGTTTATGCGTGAGGAGCAGGGCA

AGCAGCAGCTACTGGACACATGGATGGAGAAGGAGAAGCCAAGGGATGTGCCTTGTAACAACCACAGCCCCACAACCCACCCAGAGGCAGGCGACGGCAG

CCCAGTCCCCAGCTACGAGTACCATGGGGACGCGCTGTAGCCATGATGACAGGCCAGCAGGCCAGCAGGCTTCTGACCATCACCAAGTGACTACTCGGCT

TCCTCCAAAGCCAGCACTTCTAGCCCCACCAGGGCCTATGGCTCTTGTGTCGTCTGGACGTGTGGAGGAGCACTCTGATGAGACAACGGTCTTCTTTCTT

CTTTCTGTTTCTTCTCATTTTTGCACAAGGCCATTATGCAGGGAAGTTTTTATCTTTAGTATTCAATGCCAAGGATGGCTGGTGATGGGGATGAACAGGG

TGAGGCATGTTCCACAGACATATGGAGGAATATAGAGCCCCCCTGTGGTGGTAGGGAGCCAAGTCAGCATCCTTAGTCTGAAGGATGCCCTGGGATAGAT

GCAGAATGGTACCTAGGAACCTGCTGACATTTTGCAGAAGGGTGAACAACTCAGACTCAGATTCCCAAAGATGTCACCTGCTCTAGCTGGACAAGCTGGA

AGACTCCACTGTCTTTCCTTCTGGGAGCTCAGAAGTTCAGACCTGGGGTCAGAAACAGAGGTGCCTGACCACCCACACAGCACACACATATGGTGGCTTC

ACATTGTACTCCAGTAACGGAGGAGTACAGGGGCTCCCAGTTGTCCAGTACCCTTGGGGTCCCTGGCAGGCTGCACACAAGCCACTCAAGGGCCCCTCAC

ATGAAGCTGATGTCCTCCTTGTGAGACAAGCTGTCGTGACAAGCAGGGCATCTCTAAACAGGCTGGAGGGCTTCACCAAGCCCTGGGACCTCTGTGGGTT

CATTTTTTTTTGCTTTTTAAACCATCTATTGGTTTTTGTCTAAAAATCAATAATGTGATGGATTTGAGGGATTTTCTTTCTGTAGCTGAAGGTGGAAGGA

GTTTATTTCATTAGTTAACCAAATACTGAGAGGAAATTAAAATATCATTACTACCAAAGATTTTTCTCAATAAAAGCTTCTATTTTGGTAACACACCTAT

ATTTTCACTCGTGGGGATGAGACCCTCAGCACTTACCATTGTAATAGCTTCTAAAACAAGCCTCATGGGCCAGCTTCATTTGATGTGCTAGCCAGCTGTA

CAAGGCCTCTCGGCACCATTGCCAGAAGTGTCTCTCTCGCCCAAGCCGAAGAAGGCAATTCCCTGCACTCGTCTTAGGGCAAGGCAGACAGTGCTGTAGT

TGTGAGCTGGGGTCCGAATCTCAGGCTTCCAAGGTTTGCACTGTTTGCTAAAATCGTGAGACCTGATGCTTCTATTTTCTCTTGTGCAGTGATGTGGTTT

CCAATGATGTTTTGTATATAGCTACTGTATCCAAAATTAGATAATTACCAAAAATTCTTTTACAGAAACCATTTTTAAAAAACAACAAAAAAAACTAAAA

AAAAAACAAAAAAACAAAACAAAACTGAATGTATACACACCCACAGGAGACTGTGGCTGAGCGTTCATCCAAATAAATTTGAATACACAA
Translation
 - UNI14239 - MRVPEKYSTLPAEDRSVHIVNICAIEDLGYLPSEGT - UNI14239 - LLNSLSVDPDAECKYGLYFRDGKRKVDYILVYHHKR

ASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDED TKIHGVGFVKIHAPWHVLCREAEF

LKLKMPTKK VYHISETRGLLKTINSVLQKITDPIQPKVAEHRPQTTKRLSYPFSREKQHL LFDLTDRDSFFDSKTRSTI VYEILKRTTCTKAKYSMG

 GITSLLANGVYSAAYPLHD GDYEGDNVEFNDRK LLYEEWASYGVFYKYQPIDLVR RKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVD

ENIPS SMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWA - UNI30749 - AATFMEHWKRKQMRLNYRWDLTGFE

EEE - UNI30749 - EAVK - UNI30749 - DHPRAEYEARVLEKSLRKESRNKE - UNI18890 - TDKVKLTWRDRFPAYFTNLVSIIFM I

AVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIE EVPKTEKSFEERLTFKAFLLKFVNSYTPIFYV

AFFKGR RFVGRPGDYVYIFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIP PKMKKFIRYLKLRRQSPSDREEYVKRKQRYEVDFNLE

PFAGLTPEYMEMI IIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIG GIWYNILRGVGKLAVIIN AFVISFTSDFIPRL

VYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICR RYKDYREPPWSEHKYDISKDFWAVLAARLAFVIVFQ NLVMFMSDFVDWVI

PDIPKDISQQIHKEKVLMVELFMREEQGKQQLLDTWMEKEKPRDVPCNNHSPTTHPEAGDGSPVPSYEYHGDAL

For any suggestions or comments, please send an email to unitrap@crg.es