Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031099 (Smarca1)
Chromosomal location
Chr X: 45162547 - 45246151 (-)
Description
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 Gene [Source:MGI (curated);Acc:Smarca1-002]
Human Ortholog
not available
Omim not available
UniTrap UNI38363
Vector Insertion
Chr X: 45214455 - 45227401
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000088973
Sequence
GGTTATTTAAAGAAGGTGGGGGGCGAGCGAAGGGGTTGGAAGCTAGTATTCTCCACCCCTGCTCTAGCAAGCTCTTTCCAGCGCAGCCACCGCTGTCGCA

CAGGAACCTCCCTTCTCCCCTTCCTCGTCCCACCTCGTCTTTCCCGCTCCAACGCCATGGAGCCGGACACGGCCACAGAGGCAGCCACCGTGGCAGTTTC

GGATGCCAGAGCCACAGTCGTGGTTGTAGAGGATGAGCAGCCCGGGCCGTCCACCTTTAAAGAGGAGGGAGCGGCTGCTGCCGCCACCGAAGGCACCACG

GCCACTGAGAAGGGCGAGAAGAAGGAG AAAATCACTTCTCCATTTCAACTCAAACTTGCTGCTAAAGCTTCCAAATCTGAAAAGGAAATGGATCCAGAA

TATGAAGAGAAAATGGTAAATATGCCCTTG AAAGCAGACCGCGCAAAGAGATTTGAGTTTTTACTGAAGCAGACGGAACTTTTTGCACATTTCATTCAG

CCTTCAGCACAGAAGTCTCCAACATCTCCTCTCAACATGAAACTGGCTCGTCCTCGAGTAAAGAAAGATGACAAGCAGAGCTTGATTTCCGTTGGAGA C

TATCGCCACAGGCGTACAGAACAAGAAGAGGATGAGGAGCTTCTCTCAGAGAGTAGGAAAACATCGAATGTGTGTGTCAGATTCGAGGTCTCCCCTTCCT

 ATGTGAAAGGAGGACCGCTGAGAGATTATCAGATCCGAGGACTAAACTGGTTGATTTCTTTGTATGAAAATGGAGTCAATGGTATTTTAGCTGATGAAA

TG GGTCTTGGGAAGACTTTACAAACCATTGCCTTGCTTGGTTACCTGAAGCACTACAGAAACATTCCTGGACCCCACATGGTTTTAGTTCCCAAGTCTA

CTTTACATAACTGGATGAATGAATTTAAACGATGGGTTCCATCTCTCCGTGTTATTTGTTTCGTTGGAGACAAAGATGTGAGA GCAGCTTTTATTCGTG

ATGAAATGATGCCAGGAGAGTGGGATGTTTGCGTGACTTCTTATGAGATGGTAATTAAAGAAAAATCTGTGTTTAAAAAGTTTCACTGGCGATACTTAGT

CATCGATGAAGCTCACAGAATAAAAAATGAAAAATCTAAG CTTTCAGAGATTGTTCGTGAGTTCAAGTCAACTAATCGCTTACTTCTAACTGGGACACC

TTTGCAGAATAACTTGCATGAGCTCTGGGCATTACTTAATTTTTTATTGCCGGATGTCTTTAATTCTGCAGAT - UNI38363 - GACTTTGATTCTT

GGTTTGACACTAAAAATTGCCTTGGTGATCAAAAGCTTGTGGAAAGACTCCATGCA - UNI38363 - GTTTTAAAACCATTTTTGTTACGCCGGATA

AAAACCGATGTAGAGAAGAGTCTGCCTCCTAAGAAGGAAATAAAGATTTACTTGGGCCTGAGTAAAATGCAACGAGAATG - UNI38363 - GTATAC

AAAAATTCTGATGAAAGATATTGATGTCTTAAACTCTTCTGGCAAGATGGACAAGATGCGACTCTTGAATATTCTGATGCAGCTCCGAAAGTGTTGTAAT

CATCCTTATCTGTTTGATGGAGCAGAGCCTGGTCCACCTTATACGACAGATGAGCACATTGTCGGCAATAGTGGTAAAATGGTCGCTCTGGATAAGCTAT

TGGCGAGAATTAAAGAACAGG GATCAAGAGTTCTCATCTTTAGCCAGATGACTCGACTGTTAGACATTTTGGAGGATTATTGTATGTGGCGTGGTTATG

AGTATTCTCGACTGGATGGACAAACCCCACATGAAGAAAGAGAG GAAGCGATAGATGCCTTCAATGCTCCAAATAGCAGCAAATTCATCTTTATGCTGA

GTACTAGGGCTGGAGGACTCGGAATTAACTTGGCAAGTGCTGATGTGGTCATCCTATATGATTCAGACTGGAATCCACAGGTTGATTTACAAGCTATG G

ATCGGGCACATCGCATTGGTCAGAAGAAGCCAGTACGAGTCTTCCGTCTCATTACAGACAACACAGTGGAAGAGAGGATTGTAGAAAGAGCTGAGATAAA

ACTGAGACTTGATTCAATTGTTATACAGCAAG GAAGACTCATTGACCAACAATCTAACAAGCTGGCAAAAGAGGAAATGCTACAAATGATCCGTCATGG

AGCTACACATGTTTTTGCCTGTAAAGAAAGTGAGCTGACAGATGAGGACATTGTAACTATTCTGGAAAGAGGAGAAAAGAAG ACTGCAGAGATGAATGA

ACGCATGCAGAAAATGGGAGAGTCATCTCTAAGAAATTTTAGAATGGACCTTGAACAAAGTTTGTACAAGTTTGAAGGAGAAGATTACAGAGAAAAACAA

AAG CTGGGTACAGTGGAATGGATTGAACCTCCTAAACGAGAACGCAAAGCCAACTATGCAGTGGATGCCTACTTTAGAGAGGCTTTACGTGTCAGCGAG

CCAAAGATCCCAAAG GCTCCTCGGCCTCCAAAACAGCCAAATGTTCAAGATTTTCAATTTTTTCCACCGCGCTTATTTGAGCTCCTGGAAAAGGAAATT

CTTTATTATCGGAAGACTATAGGTTACAAG GTCCCAAGAAATCCTGAGATCCCCAACCCAGCTATAGCTCAAAGAGAAGAGCAAAAAAAGATTGATGGA

GCGGAACCTCTTACACCACAAGAGACTGAAGAGAAGGATAAACTTCTCACACAA GGTTTCACAAACTGGACTAAGCGAGATTTTAACCAGTTTATTAAA

GCTAATGAGAAGTATGGGAGAGATGACATTGATAATATAGCTCGAGAGGTGGAGGGCAAGTCCCCTGAGGAGGTCATGGAGTATTCAG CTGTATTTTGG

GAACGCTGCAATGAATTACAGGACATTGAGAAAATTATGGCTCAAATTGAACGTGGAGAAGCAAGAATTCAGCGAAGGATCAGTATTAAGAAAGCACTGG

ATGCCAAA ATTGCAAGATACAAGGCTCCATTTCATCAGTTGCGTATTCAGTATGGAACCAGTAAAGGAAAGAACTATACTGAAGAGGAAGACAGATTCT

TGATCTGTATGTTACACAAAATGGGTTTTGACAGAGAAAATGTATATGAAGAATTAAGGCAGTGTGTACGGAATGCTCCCCAGTTTAGATTTGACTGGTT

CATCAAGTCGAGAACTGCCATG GAATTTCAGAGACGCTGTAATACTTTGATTTCATTGATTGAAAAAGAAAATATGGAAATTGAGGAAAGAGAGAGAGC

AGAAAAGAAGAAACGGGCAACTAAAACTCCAATGGTAAAATTTTCAGCATTTTCCTAACTTTTAGGTAGATCTCATTTTTTTTACATAATTACAAATGTT

TATACTATGTTTGATTCTGGGTTTTATGAAATGCTAATTTGTTTTAGATCAAAGAAGAATCACATCACAAACGTACTTCTCTTTTTGTTTGAAGAATATG

TGGTTAGGAATTCCCTTGTTACAAAACTCAGTATTTAAGAAATTCCTCGCAAATTTAAGCAGAGGCATAATACAAGTGAGATCCTATGAATTGAGACTAG

GTCGCCGTGGGGACAGCGGAAGGTTAGAGTAGTGATGGGATGGTGTGAAGACTGAAACCTGAGTTGATCAAATAAGTTGTTTGATCTTTGTGGAACTGTG

TATACAAAAGAACCCTGAGCAGACAAGATAGCCTGTTTTGGCAATAAGTTCACTGCTGGATAAAAATGTGATTTTAATCCTGTTGGGTTGCTGTGTATAT

CAATGATTCAAAGTATTCTGTTTGAGTGTGTTAAGTAGTGCACCATATTTCATCAAATCTATGATGCTTTCTGTTGTAAGACAAAACTTTTTTGTGCTAC

TAAGAGATATGATGCCAAGTATCATCTGTTATCAGTTGTAAAATACATCCTGATTTCAGAGGTGCTAATGGGGAAAAGAAATGTGCATCATAGAAGATAT

GAAATATGGTGTGTTAACATTTACCTTAACGTTATTAAATAACACTCACAAATAAACATTTCCTCAGAAACTTTAAATATTAAGTAGTTCTTTAAGATAA

AAGTACATTTATAAGCCATGTGTAAGTAGATACTTGATGACTATTTTTGATGGATATTTTATGTCTTTTCATAAAAAGAAACACCTTTAAAAGTTATTTT

ACATTGGGTTATATAGTTTGTTGGGCTATATAGAGCATTAACTGTGAGTCTAACATTGAAGTGAATATTCATGTTAAAAATTTTAATGCATTTACATCCT

AGATTTAACATTGTTGGGCCATTTAAAAGTGTGCATATTGGAGCAGAACATTAAATCTGTTTCCATTTTAGTCACAGAAAAGAAAAGCAGAGTCAGCTAC

TGAGAGCTCTGGAAGGAAGGATGTCAAGAAGGTGAAATCCTAAAGCCTAGAAATAAAGTTTTAAATGGGAAACTGCTATTTTCTTGTCCCCATCTTCAAA

TGCTAATTACTACTTCCAGTGTATTCATGGTACTCTAAGGAAAAAAAAAAGGAATACTCTTTGGTTTTGATTTCTTGCATATTTTATATATTTTACAATG

CTTTCTACCTGAAATGTGTAGCTTTCTATTTTATGCATTCTAGTATTTTCTGTACTGTATTTTGTGCATTTCATGTCTTCATCAAATTCCTCTCAGTCCT

TGTTTTTTTGAAGCTTGTGCTGAGGTTTTAGCTTTTCTATGTTTTCTATGCCGCTGCTTTGAAAGAGAACCTAGATTCTATAGCTGTATTATTGTTGTTT

CAGACTTTACATTTATATGGCTGTGGACAAAATGAATTAAAACGATTTGAGGAGAAAGA
Translation
MEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKE KITSPFQLKLAAKASKSEKEMDPEYEEKMVNMPL KADRAKR

FEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGD DYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY YVKGGPLRDYQIRG

LNWLISLYENGVNGILADEM GLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVR AAFIRDEMMPGEWDVCVT

SYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSK LSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAD - UNI38363 - DFDSWFD

TKNCLGDQKLVERLHA - UNI38363 - VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREW - UNI38363 - WYTKILMKDIDVLNSSGKM

DKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQG GSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEERE

 EAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAM DRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQG G

RLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKK TAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQK LGTVEWIEP

PKRERKANYAVDAYFREALRVSEPKIPK APRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYK VPRNPEIPNPAIAQREEQKKIDGAEPLTPQET

EEKDKLLTQ GFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAK IAR

YKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM EFQRRCNTLISLIEKENMEIEERERAEKKKR

ATKTPMVKFSAFS
Transcript ENSMUST00000115035
Sequence
AGCGCAGCCACCGCTGTCGCACAGGAACCTCCCTTCTCCCCTTCCTCGTCCCACCTCGTCTTTCCCGCTCCAACGCCATGGAGCCGGACACGGCCACAGA

GGCAGCCACCGTGGCAGTTTCGGATGCCAGAGCCACAGTCGTGGTTGTAGAGGATGAGCAGCCCGGGCCGTCCACCTTTAAAGAGGAG AAAATCACTTC

TCCATTTCAACTCAAACTTGCTGCTAAAGCTTCCAAATCTGAAAAGGAAATGGATCCAGAATATGAAGAGAAAATG AAAGCAGACCGCGCAAAGAGATT

TGAGTTTTTACTGAAGCAGACGGAACTTTTTGCACATTTCATTCAGCCTTCAGCACAGAAGTCTCCAACATCTCCTCTCAACATGAAACTGGCTCGTCCT

CGAGTAAAGAAAGATGACAAGCAGAGCTTGATTTCCGTTGGAGA CTATCGCCACAGGCGTACAGAACAAGAAGAGGATGAGGAGCTTCTCTCAGAGAGT

AGGAAAACATCGAATGTGTGTGTCAGATTCGAGGTCTCCCCTTCCT ATGTGAAAGGAGGACCGCTGAGAGATTATCAGATCCGAGGACTAAACTGGTTG

ATTTCTTTGTATGAAAATGGAGTCAATGGTATTTTAGCTGATGAAATG GGTCTTGGGAAGACTTTACAAACCATTGCCTTGCTTGGTTACCTGAAGCAC

TACAGAAACATTCCTGGACCCCACATGGTTTTAGTTCCCAAGTCTACTTTACATAACTGGATGAATGAATTTAAACGATGGGTTCCATCTCTCCGTGTTA

TTTGTTTCGTTGGAGACAAAGATGTGAGA GCAGCTTTTATTCGTGATGAAATGATGCCAGGAGAGTGGGATGTTTGCGTGACTTCTTATGAGATGGTAA

TTAAAGAAAAATCTGTGTTTAAAAAGTTTCACTGGCGATACTTAGTCATCGATGAAGCTCACAGAATAAAAAATGAAAAATCTAAG CTTTCAGAGATTG

TTCGTGAGTTCAAGTCAACTAATCGCTTACTTCTAACTGGGACACCTTTGCAGAATAACTTGCATGAGCTCTGGGCATTACTTAATTTTTTATTGCCGGA

TGTCTTTAATTCTGCAGAT - UNI38363 - GACTTTGATTCTTGGTTTGACACTAAAAATTGCCTTGGTGATCAAAAGCTTGTGGAAAGACTCCATG

CA - UNI38363 - GTTTTAAAACCATTTTTGTTACGCCGGATAAAAACCGATGTAGAGAAGAGTCTGCCTCCTAAGAAGGAAATAAAGATTTACTTG

GGCCTGAGTAAAATGCAACGAGAATG - UNI38363 - GTATACAAAAATTCTGATGAAAGATATTGATGTCTTAAACTCTTCTGGCAAGATGGACAA

GATGCGACTCTTGAATATTCTGATGCAGCTCCGAAAGTGTTGTAATCATCCTTATCTGTTTGATGGAGCAGAGCCTGGTCCACCTTATACGACAGATGAG

CACATTGTCGGCAATAGTGGTAAAATGGTCGCTCTGGATAAGCTATTGGCGAGAATTAAAGAACAGG GATCAAGAGTTCTCATCTTTAGCCAGATGACT

CGACTGTTAGACATTTTGGAGGATTATTGTATGTGGCGTGGTTATGAGTATTCTCGACTGGATGGACAAACCCCACATGAAGAAAGAGAG GATAAGTTC

CTGGAAGTGGAATTATTGGGTCAAAGG GAAGCGATAGATGCCTTCAATGCTCCAAATAGCAGCAAATTCATCTTTATGCTGAGTACTAGGGCTGGAGGA

CTCGGAATTAACTTGGCAAGTGCTGATGTGGTCATCCTATATGATTCAGACTGGAATCCACAGGTTGATTTACAAGCTATG GATCGGGCACATCGCATT

GGTCAGAAGAAGCCAGTACGAGTCTTCCGTCTCATTACAGACAACACAGTGGAAGAGAGGATTGTAGAAAGAGCTGAGATAAAACTGAGACTTGATTCAA

TTGTTATACAGCAAG GAAGACTCATTGACCAACAATCTAACAAGCTGGCAAAAGAGGAAATGCTACAAATGATCCGTCATGGAGCTACACATGTTTTTG

CCTGTAAAGAAAGTGAGCTGACAGATGAGGACATTGTAACTATTCTGGAAAGAGGAGAAAAGAAG ACTGCAGAGATGAATGAACGCATGCAGAAAATGG

GAGAGTCATCTCTAAGAAATTTTAGAATGGACCTTGAACAAAGTTTGTACAAGTTTGAAGGAGAAGATTACAGAGAAAAACAAAAG CTGGGTACAGTGG

AATGGATTGAACCTCCTAAACGAGAACGCAAAGCCAACTATGCAGTGGATGCCTACTTTAGAGAGGCTTTACGTGTCAGCGAGCCAAAGATCCCAAAG G

CTCCTCGGCCTCCAAAACAGCCAAATGTTCAAGATTTTCAATTTTTTCCACCGCGCTTATTTGAGCTCCTGGAAAAGGAAATTCTTTATTATCGGAAGAC

TATAGGTTACAAG GTCCCAAGAAATCCTGAGATCCCCAACCCAGCTATAGCTCAAAGAGAAGAGCAAAAAAAGATTGATGGAGCGGAACCTCTTACACC

ACAAGAGACTGAAGAGAAGGATAAACTTCTCACACAA GGTTTCACAAACTGGACTAAGCGAGATTTTAACCAGTTTATTAAAGCTAATGAGAAGTATGG

GAGAGATGACATTGATAATATAGCTCGAGAGGTGGAGGGCAAGTCCCCTGAGGAGGTCATGGAGTATTCAG CTGTATTTTGGGAACGCTGCAATGAATT

ACAGGACATTGAGAAAATTATGGCTCAAATTGAACGTGGAGAAGCAAGAATTCAGCGAAGGATCAGTATTAAGAAAGCACTGGATGCCAAA ATTGCAAG

ATACAAGGCTCCATTTCATCAGTTGCGTATTCAGTATGGAACCAGTAAAGGAAAGAACTATACTGAAGAGGAAGACAGATTCTTGATCTGTATGTTACAC

AAAATGGGTTTTGACAGAGAAAATGTATATGAAGAATTAAGGCAGTGTGTACGGAATGCTCCCCAGTTTAGATTTGACTGGTTCATCAAGTCGAGAACTG

CCATG GAATTTCAGAGACGCTGTAATACTTTGATTTCATTGATTGAAAAAGAAAATATGGAAATTGAGGAAAGAGAGAGAGCAGAAAAGAAGAAACGGG

CAACTAAAACTCCAATGGTAAAATTTTCAGCATTTTCCTAACTTTTAG ATTTAACATTGTTGGGCCATTTAAAAGTGTGCATATTGGAGCAGAACATTA

AATCTGTTTCCATTTTAGTCACAGAAAAGAAAAGCAGAGTCAGCTACTGAGAGCTCTGGAAGGAAGGATGTCAAGAAGGTGAAATCCTAAAGCCTAGAAA

TAAAGTTTTAAATGGGAAACTGCTATTTTCTTGTCCCCATCTTCAAATGCTAATTACTACTTCCAGTGTATTCATGGTACTCTAAGGAAAAAAAAAAGGA

ATACTCTTTGGTTTTGATTTCTTGCATATTTTATATATTTTACAATGCTTTCTACCTGAAATGTGTAGCTTTCTATTTTATGCATTCTAGTATTTTCTGT

ACTGTATTTTGTGCATTTCATGTCTTCATCAAATTCCTCTCAGTCCTTGTTTTTTTGAAGCTTGTGCTGAGGTTTTAGCTTTTCTATGTTTTCTATGCCG

CTGCTTTGAAAGAGAACCTAGATTCTATAGCTGTATTATTGTTGTTTCAGACTTTACATTTATATGGCTGTGGACAAAATGAATTAAAACGATTTGAGGA

GAAAGA
Translation
MEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEE KITSPFQLKLAAKASKSEKEMDPEYEEKM KADRAKRFEFLLKQTELFAHFIQPSAQKSPTS

PLNMKLARPRVKKDDKQSLISVGD DYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY YVKGGPLRDYQIRGLNWLISLYENGVNGILADEM GLGK

TLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVR AAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEA

HRIKNEKSK LSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAD - UNI38363 - DFDSWFDTKNCLGDQKLVERLHA - UNI383

63 - VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREW - UNI38363 - WYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGA

EPGPPYTTDEHIVGNSGKMVALDKLLARIKEQG GSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEERE DKFLEVELLGQR EAIDAFNAPNS

SKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAM DRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQG GRLIDQQSNKLAK

EEMLQMIRHGATHVFACKESELTDEDIVTILERGEKK TAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQK LGTVEWIEPPKRERKANYAVD

AYFREALRVSEPKIPK APRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYK VPRNPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQ GF

TNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAK IARYKAPFHQLRIQY

GTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM EFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMVKFSAF

S 
Transcript ENSMUST00000115034
Sequence
GGCAGTCCTTAGAGGGACTGTGGGCTTTCCAAGGAAACACTATGCAGAGAAAGACCAATAGCACTCATAAGCAGAGGAGTTCTTTGTGCAAGAAGGGGAG

AGCGCCCCAAG GAACCTCCCTTCTCCCCTTCCTCGTCCCACCTCGTCTTTCCCGCTCCAACGCCATGGAGCCGGACACGGCCACAGAGGCAGCCACCGT

GGCAGTTTCGGATGCCAGAGCCACAGTCGTGGTTGTAGAGGATGAGCAGCCCGGGCCGTCCACCTTTAAAGAGGAGGGAGCGGCTGCTGCCGCCACCGAA

GGCACCACGGCCACTGAGAAGGGCGAGAAGAAGGAG CCAGCTATTCACTTACAACTTTTAAAGACCTCATCTACTTTCATCAGAAGAAATTTATCTACC

ATAAAATCATGA
Translation
MQRKTNSTHKQRSSLCKKGRAPQG GTSLLPFLVPPRLSRSNAMEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKE

 PAIHLQLLKTSSTFIRRNLSTIKS
Transcript ENSMUST00000077569
Sequence
GGTTGGAAGCTAGTATTCTCCACCCCTGCTCTAGCAAGCTCTTTCCAGCGCAGCCACCGCTGTCGCACAGGAACCTCCCTTCTCCCCTTCCTCGTCCCAC

CTCGTCTTTCCCGCTCCAACGCCATGGAGCCGGACACGGCCACAGAGGCAGCCACCGTGGCAGTTTCGGATGCCAGAGCCACAGTCGTGGTTGTAGAGGA

TGAGCAGCCCGGGCCGTCCACCTTTAAAGAGGAGGGAGCGGCTGCTGCCGCCACCGAAGGCACCACGGCCACTGAGAAGGGCGAGAAGAAGGAG AAAAT

CACTTCTCCATTTCAACTCAAACTTGCTGCTAAAGCTTCCAAATCTGAAAAGGAAATGGATCCAGAATATGAAGAGAAAATGGTAAATATGCCCTTG AA

AGCAGACCGCGCAAAGAGATTTGAGTTTTTACTGAAGCAGACGGAACTTTTTGCACATTTCATTCAGCCTTCAGCACAGAAGTCTCCAACATCTCCTCTC

AACATGAAACTGGCTCGTCCTCGAGTAAAGAAAGATGACAAGCAGAGCTTGATTTCCGTTGGAGA CTATCGCCACAGGCGTACAGAACAAGAAGAGGAT

GAGGAGCTTCTCTCAGAGAGTAGGAAAACATCGAATGTGTGTGTCAGATTCGAGGTCTCCCCTTCCT ATGTGAAAGGAGGACCGCTGAGAGATTATCAG

ATCCGAGGACTAAACTGGTTGATTTCTTTGTATGAAAATGGAGTCAATGGTATTTTAGCTGATGAAATG GGTCTTGGGAAGACTTTACAAACCATTGCC

TTGCTTGGTTACCTGAAGCACTACAGAAACATTCCTGGACCCCACATGGTTTTAGTTCCCAAGTCTACTTTACATAACTGGATGAATGAATTTAAACGAT

GGGTTCCATCTCTCCGTGTTATTTGTTTCGTTGGAGACAAAGATGTGAGA GCAGCTTTTATTCGTGATGAAATGATGCCAGGAGAGTGGGATGTTTGCG

TGACTTCTTATGAGATGGTAATTAAAGAAAAATCTGTGTTTAAAAAGTTTCACTGGCGATACTTAGTCATCGATGAAGCTCACAGAATAAAAAATGAAAA

ATCTAAG CTTTCAGAGATTGTTCGTGAGTTCAAGTCAACTAATCGCTTACTTCTAACTGGGACACCTTTGCAGAATAACTTGCATGAGCTCTGGGCATT

ACTTAATTTTTTATTGCCGGATGTCTTTAATTCTGCAGAT - UNI38363 - GACTTTGATTCTTGGTTTGACACTAAAAATTGCCTTGGTGATCAAA

AGCTTGTGGAAAGACTCCATGCA - UNI38363 - GTTTTAAAACCATTTTTGTTACGCCGGATAAAAACCGATGTAGAGAAGAGTCTGCCTCCTAAG

AAGGAAATAAAGATTTACTTGGGCCTGAGTAAAATGCAACGAGAATG - UNI38363 - GTATACAAAAATTCTGATGAAAGATATTGATGTCTTAAA

CTCTTCTGGCAAGATGGACAAGATGCGACTCTTGAATATTCTGATGCAGCTCCGAAAGTGTTGTAATCATCCTTATCTGTTTGATGGAGCAGAGCCTGGT

CCACCTTATACGACAGATGAGCACATTGTCGGCAATAGTGGTAAAATGGTCGCTCTGGATAAGCTATTGGCGAGAATTAAAGAACAGG GATCAAGAGTT

CTCATCTTTAGCCAGATGACTCGACTGTTAGACATTTTGGAGGATTATTGTATGTGGCGTGGTTATGAGTATTCTCGACTGGATGGACAAACCCCACATG

AAGAAAGAGAG GAAGCGATAGATGCCTTCAATGCTCCAAATAGCAGCAAATTCATCTTTATGCTGAGTACTAGGGCTGGAGGACTCGGAATTAACTTGG

CAAGTGCTGATGTGGTCATCCTATATGATTCAGACTGGAATCCACAGGTTGATTTACAAGCTATG GATCGGGCACATCGCATTGGTCAGAAGAAGCCAG

TACGAGTCTTCCGTCTCATTACAGACAACACAGTGGAAGAGAGGATTGTAGAAAGAGCTGAGATAAAACTGAGACTTGATTCAATTGTTATACAGCAAG 

GAAGACTCATTGACCAACAATCTAACAAGCTGGCAAAAGAGGAAATGCTACAAATGATCCGTCATGGAGCTACACATGTTTTTGCCTGTAAAGAAAGTGA

GCTGACAGATGAGGACATTGTAACTATTCTGGAAAGAGGAGAAAAGAAG ACTGCAGAGATGAATGAACGCATGCAGAAAATGGGAGAGTCATCTCTAAG

AAATTTTAGAATGGACCTTGAACAAAGTTTGTACAAGTTTGAAGGAGAAGATTACAGAGAAAAACAAAAG CTGGGTACAGTGGAATGGATTGAACCTCC

TAAACGAGAACGCAAAGCCAACTATGCAGTGGATGCCTACTTTAGAGAGGCTTTACGTGTCAGCGAGCCAAAGATCCCAAAG GCTCCTCGGCCTCCAAA

ACAGCCAAATGTTCAAGATTTTCAATTTTTTCCACCGCGCTTATTTGAGCTCCTGGAAAAGGAAATTCTTTATTATCGGAAGACTATAGGTTACAAG GT

CCCAAGAAATCCTGAGATCCCCAACCCAGCTATAGCTCAAAGAGAAGAGCAAAAAAAGATTGATGGAGCGGAACCTCTTACACCACAAGAGACTGAAGAG

AAGGATAAACTTCTCACACAA GGTTTCACAAACTGGACTAAGCGAGATTTTAACCAGTTTATTAAAGCTAATGAGAAGTATGGGAGAGATGACATTGAT

AATATAGCTCGAGAGGTGGAGGGCAAGTCCCCTGAGGAGGTCATGGAGTATTCAG CTGTATTTTGGGAACGCTGCAATGAATTACAGGACATTGAGAAA

ATTATGGCTCAAATTGAACGTGGAGAAGCAAGAATTCAGCGAAGGATCAGTATTAAGAAAGCACTGGATGCCAAA ATTGCAAGATACAAGGCTCCATTT

CATCAGTTGCGTATTCAGTATGGAACCAGTAAAGGAAAGAACTATACTGAAGAGGAAGACAGATTCTTGATCTGTATGTTACACAAAATGGGTTTTGACA

GAGAAAATGTATATGAAGAATTAAGGCAGTGTGTACGGAATGCTCCCCAGTTTAGATTTGACTGGTTCATCAAGTCGAGAACTGCCATG GAATTTCAGA

GACGCTGTAATACTTTGATTTCATTGATTGAAAAAGAAAATATGGAAATTGAGGAAAGAGAGAGAGCAGAAAAGAAGAAACGGGCAACTAAAACTCCAAT

GGTAAAATTTTCAGCATTTTCCTAACTTTTAG TCACAGAAAAGAAAAGCAGAGTCAGCTACTGAGAGCTCTGGAAGGAAGGATGTCAAGAAGGTGAAAT

CCTAAAGCCTAGAAATAAAGTTTTAAATGGGAAACTGCTATTTTCTTGTCCCCATCTTCAAATGCTAATTACTACTTCCAGTGTATTCATGGTACTCTAA

GGAAAAAAAAAAGGAATACTCTTTGGTTTTGATTTCTTGCATATTTTATATATTTTACAATGCTTTCTACCTGAAATGTGTAGCTTTCTATTTTATGCAT

TCTAGTATTTTCTGTACTGTATTTTGTGCATTTCATGTCTTCATCAAATTCCTCTCAGTCCTTGTTTTTTTGAAGCTTGTGCTGAGGTTTTAGCTTTTCT

ATGTTTTCTATGCCGCTGCTTTGAAAGAGAACCTAGATTCTATAGCTGTATTATTGTTGTTTCAGACTTTACATTTATATGGCTGTGGACAAAATGAATT

AAAACGATTTGAGGAGAAAGACTTTCTCACTTCTTTGTTGCTTTCTTTTCTATGGAGTCTGGGTTTGTGTGTGTGTAACTGCATACTGTGATTAGCATAA

TCATTGTTTCTTTGAGGTCATCTACATACTTTTTCCTAAGGAAATAAAGGGTAAGAAAGAAAAAATCTTAAAAATAAACCCTAATATTTGATACTGTGTT

TGCTGTCAGTGTGCGTTACATTTAAATTATTCTCTAAATATTCAAGTGGGAAAAATATAATAAAGGACTGTCTATAAGAAATAT
Translation
MEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKE KITSPFQLKLAAKASKSEKEMDPEYEEKMVNMPL KADRAKR

FEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGD DYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY YVKGGPLRDYQIRG

LNWLISLYENGVNGILADEM GLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVR AAFIRDEMMPGEWDVCVT

SYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSK LSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAD - UNI38363 - DFDSWFD

TKNCLGDQKLVERLHA - UNI38363 - VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREW - UNI38363 - WYTKILMKDIDVLNSSGKM

DKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQG GSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEERE

 EAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAM DRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQG G

RLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKK TAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQK LGTVEWIEP

PKRERKANYAVDAYFREALRVSEPKIPK APRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYK VPRNPEIPNPAIAQREEQKKIDGAEPLTPQET

EEKDKLLTQ GFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAK IAR

YKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM EFQRRCNTLISLIEKENMEIEERERAEKKKR

ATKTPMVKFSAFS 
Transcript ENSMUST00000115040
Sequence
ATGGAGCCGGACACGGCCACAGAGGCAGCCACCGTGGCAGTTTCGGATGCCAGAGCCACAGTCGTGGTTGTAGAGGATGAGCAGCCCGGGCCGTCCACCT

TTAAAGAGGAG AAAATCACTTCTCCATTTCAACTCAAACTTGCTGCTAAAGCTTCCAAATCTGAAAAGGAAATGGATCCAGAATATGAAGAGAAAATG 

AAAGCAGACCGCGCAAAGAGATTTGAGTTTTTACTGAAGCAGACGGAACTTTTTGCACATTTCATTCAGCCTTCAGCACAGAAGTCTCCAACATCTCCTC

TCAACATGAAACTGGCTCGTCCTCGAGTAAAGAAAGATGACAAGCAGAGCTTGATTTCCGTTGGAGA CTATCGCCACAGGCGTACAGAACAAGAAGAGG

ATGAGGAGCTTCTCTCAGAGAGTAGGAAAACATCGAATGTGTGTGTCAGATTCGAGGTCTCCCCTTCCT ATGTGAAAGGAGGACCGCTGAGAGATTATC

AGATCCGAGGACTAAACTGGTTGATTTCTTTGTATGAAAATGGAGTCAATGGTATTTTAGCTGATGAAATG GGTCTTGGGAAGACTTTACAAACCATTG

CCTTGCTTGGTTACCTGAAGCACTACAGAAACATTCCTGGACCCCACATGGTTTTAGTTCCCAAGTCTACTTTACATAACTGGATGAATGAATTTAAACG

ATGGGTTCCATCTCTCCGTGTTATTTGTTTCGTTGGAGACAAAGATGTGAGA GCAGCTTTTATTCGTGATGAAATGATGCCAGGAGAGTGGGATGTTTG

CGTGACTTCTTATGAGATGGTAATTAAAGAAAAATCTGTGTTTAAAAAGTTTCACTGGCGATACTTAGTCATCGATGAAGCTCACAGAATAAAAAATGAA

AAATCTAAG CTTTCAGAGATTGTTCGTGAGTTCAAGTCAACTAATCGCTTACTTCTAACTGGGACACCTTTGCAGAATAACTTGCATGAGCTCTGGGCA

TTACTTAATTTTTTATTGCCGGATGTCTTTAATTCTGCAGAT - UNI38363 - GACTTTGATTCTTGGTTTGACACTAAAAATTGCCTTGGTGATCA

AAAGCTTGTGGAAAGACTCCATGCA - UNI38363 - GTTTTAAAACCATTTTTGTTACGCCGGATAAAAACCGATGTAGAGAAGAGTCTGCCTCCTA

AGAAGGAAATAAAGATTTACTTGGGCCTGAGTAAAATGCAACGAGAATG - UNI38363 - GTATACAAAAATTCTGATGAAAGATATTGATGTCTTA

AACTCTTCTGGCAAGATGGACAAGATGCGACTCTTGAATATTCTGATGCAGCTCCGAAAGTGTTGTAATCATCCTTATCTGTTTGATGGAGCAGAGCCTG

GTCCACCTTATACGACAGATGAGCACATTGTCGGCAATAGTGGTAAAATGGTCGCTCTGGATAAGCTATTGGCGAGAATTAAAGAACAGG GATCAAGAG

TTCTCATCTTTAGCCAGATGACTCGACTGTTAGACATTTTGGAGGATTATTGTATGTGGCGTGGTTATGAGTATTCTCGACTGGATGGACAAACCCCACA

TGAAGAAAGAGAG GATAAGTTCCTGGAAGTGGAATTATTGGGTCAAAGG GAAGCGATAGATGCCTTCAATGCTCCAAATAGCAGCAAATTCATCTTTA

TGCTGAGTACTAGGGCTGGAGGACTCGGAATTAACTTGGCAAGTGCTGATGTGGTCATCCTATATGATTCAGACTGGAATCCACAGGTTGATTTACAAGC

TATG GATCGGGCACATCGCATTGGTCAGAAGAAGCCAGTACGAGTCTTCCGTCTCATTACAGACAACACAGTGGAAGAGAGGATTGTAGAAAGAGCTGA

GATAAAACTGAGACTTGATTCAATTGTTATACAGCAAG GAAGACTCATTGACCAACAATCTAACAAGCTGGCAAAAGAGGAAATGCTACAAATGATCCG

TCATGGAGCTACACATGTTTTTGCCTGTAAAGAAAGTGAGCTGACAGATGAGGACATTGTAACTATTCTGGAAAGAGGAGAAAAGAAG ACTGCAGAGAT

GAATGAACGCATGCAGAAAATGGGAGAGTCATCTCTAAGAAATTTTAGAATGGACCTTGAACAAAGTTTGTACAAGTTTGAAGGAGAAGATTACAGAGAA

AAACAAAAG CTGGGTACAGTGGAATGGATTGAACCTCCTAAACGAGAACGCAAAGCCAACTATGCAGTGGATGCCTACTTTAGAGAGGCTTTACGTGTC

AGCGAGCCAAAGATCCCAAAG GCTCCTCGGCCTCCAAAACAGCCAAATGTTCAAGATTTTCAATTTTTTCCACCGCGCTTATTTGAGCTCCTGGAAAAG

GAAATTCTTTATTATCGGAAGACTATAGGTTACAAG GTCCCAAGAAATCCTGAGATCCCCAACCCAGCTATAGCTCAAAGAGAAGAGCAAAAAAAGATT

GATGGAGCGGAACCTCTTACACCACAAGAGACTGAAGAGAAGGATAAACTTCTCACACAA GGTTTCACAAACTGGACTAAGCGAGATTTTAACCAGTTT

ATTAAAGCTAATGAGAAGTATGGGAGAGATGACATTGATAATATAGCTCGAGAGGTGGAGGGCAAGTCCCCTGAGGAGGTCATGGAGTATTCAG CTGTA

TTTTGGGAACGCTGCAATGAATTACAGGACATTGAGAAAATTATGGCTCAAATTGAACGTGGAGAAGCAAGAATTCAGCGAAGGATCAGTATTAAGAAAG

CACTGGATGCCAAA ATTGCAAGATACAAGGCTCCATTTCATCAGTTGCGTATTCAGTATGGAACCAGTAAAGGAAAGAACTATACTGAAGAGGAAGACA

GATTCTTGATCTGTATGTTACACAAAATGGGTTTTGACAGAGAAAATGTATATGAAGAATTAAGGCAGTGTGTACGGAATGCTCCCCAGTTTAGATTTGA

CTGGTTCATCAAGTCGAGAACTGCCATG GAATTTCAGAGACGCTGTAATACTTTGATTTCATTGATTGAAAAAGAAAATATGGAAATTGAGGAAAGAGA

GAGAGCAGAAAAGAAGAAACGGGCAACTAAAACTCCAATGGTAAAATTTTCAGCATTTTCCTAACTTTTAG TCACAGAAAAGAAAAGCAGAGTCAGCTA

CTGAGAGCTCTGGAAGGAAGGATGTCAAGAAGGTGAAATCCTAAAGCCTAGAAATAAAGTTTTAAATGGGAAACTGCTATTTTCTTGTCCCCATCTTCAA

ATGCTAATTACTACTTCCAGTGTATTCATGGTACTCTAAGGAAAAAAAAAAGGAATACTCTTTGGTTTTGATTTCTTGCATATTTTATATATTTTACAAT

GCTTTCTACCTGAAATGTGTAGCTTTCTATTTTATGCATTCTAGTATTTTCTGTACTGTATTTTGTGCATTTCATGTCTTCATCAAATTCCTCTCAGTCC

TTGTTTTTTTGAAGCTTGTGCTGAGGTTTTAGCTTTTCTATGTTTTCTATGCCGCTGCTTTGAAAGAGAACCTAGATTCTATAGCTGTATTATTGTTGTT

TCAGACTTTACATTTATATGGCTGTGGACAAAATGAATTAAAACGATTTGAGGAGAAAGACTTTCTCACTTCTTTGTTGCTTTCTTTTCTATGGAGTCTG

GGTTTGTGTGTGTGTAACTGCATACTGTGATTAGCATAATCATTGTTTCTTTGAGGTCATCTACATACTTTTTCCTAAGGAAATAAAGGGTAAGAAAGAA

AAAATCTTAAAAATAAACCCTAATATTTGATACTGTGTTTGCTGTCAGTGTGCGTTACATTTAAATTATTCTCTAAATATTCAAGTGGGAAAAATATAAT

AAAGGACTGTCTATAAGAAATAT
Translation
MEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEE KITSPFQLKLAAKASKSEKEMDPEYEEKM KADRAKRFEFLLKQTELFAHFIQPSAQKSPTS

PLNMKLARPRVKKDDKQSLISVGD DYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY YVKGGPLRDYQIRGLNWLISLYENGVNGILADEM GLGK

TLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVR AAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEA

HRIKNEKSK LSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAD - UNI38363 - DFDSWFDTKNCLGDQKLVERLHA - UNI383

63 - VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREW - UNI38363 - WYTKILMKDIDVLNSSGKMDKMRLLNILMQLRKCCNHPYLFDGA

EPGPPYTTDEHIVGNSGKMVALDKLLARIKEQG GSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEERE DKFLEVELLGQR EAIDAFNAPNS

SKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAM DRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQG GRLIDQQSNKLAK

EEMLQMIRHGATHVFACKESELTDEDIVTILERGEKK TAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQK LGTVEWIEPPKRERKANYAVD

AYFREALRVSEPKIPK APRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYK VPRNPEIPNPAIAQREEQKKIDGAEPLTPQETEEKDKLLTQ GF

TNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAK IARYKAPFHQLRIQY

GTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM EFQRRCNTLISLIEKENMEIEERERAEKKKRATKTPMVKFSAF

S 
Transcript ENSMUST00000101616
Sequence
GGTTGGAAGCTAGTATTCTCCACCCCTGCTCTAGCAAGCTCTTTCCAGCGCAGCCACCGCTGTCGCACAGGAACCTCCCTTCTCCCCTTCCTCGTCCCAC

CTCGTCTTTCCCGCTCCAACGCCATGGAGCCGGACACGGCCACAGAGGCAGCCACCGTGGCAGTTTCGGATGCCAGAGCCACAGTCGTGGTTGTAGAGGA

TGAGCAGCCCGGGCCGTCCACCTTTAAAGAGGAGGGAGCGGCTGCTGCCGCCACCGAAGGCACCACGGCCACTGAGAAGGGCGAGAAGAAGGAG AAAAT

CACTTCTCCATTTCAACTCAAACTTGCTGCTAAAGCTTCCAAATCTGAAAAGGAAATGGATCCAGAATATGAAGAGAAAATGGTAAATATGCCCTTG AA

AGCAGACCGCGCAAAGAGATTTGAGTTTTTACTGAAGCAGACGGAACTTTTTGCACATTTCATTCAGCCTTCAGCACAGAAGTCTCCAACATCTCCTCTC

AACATGAAACTGGCTCGTCCTCGAGTAAAGAAAGATGACAAGCAGAGCTTGATTTCCGTTGGAGA CTATCGCCACAGGCGTACAGAACAAGAAGAGGAT

GAGGAGCTTCTCTCAGAGAGTAGGAAAACATCGAATGTGTGTGTCAGATTCGAGGTCTCCCCTTCCT ATGTGAAAGGAGGACCGCTGAGAGATTATCAG

ATCCGAGGACTAAACTGGTTGATTTCTTTGTATGAAAATGGAGTCAATGGTATTTTAGCTGATGAAATG GGTCTTGGGAAGACTTTACAAACCATTGCC

TTGCTTGGTTACCTGAAGCACTACAGAAACATTCCTGGACCCCACATGGTTTTAGTTCCCAAGTCTACTTTACATAACTGGATGAATGAATTTAAACGAT

GGGTTCCATCTCTCCGTGTTATTTGTTTCGTTGGAGACAAAGATGTGAGA GCAGCTTTTATTCGTGATGAAATGATGCCAGGAGAGTGGGATGTTTGCG

TGACTTCTTATGAGATGGTAATTAAAGAAAAATCTGTGTTTAAAAAGTTTCACTGGCGATACTTAGTCATCGATGAAGCTCACAGAATAAAAAATGAAAA

ATCTAAG CTTTCAGAGATTGTTCGTGAGTTCAAGTCAACTAATCGCTTACTTCTAACTGGGACACCTTTGCAGAATAACTTGCATGAGCTCTGGGCATT

ACTTAATTTTTTATTGCCGGATGTCTTTAATTCTGCAGAT - UNI38363 - GACTTTGATTCTTGGTTTGACACTAAAAATTGCCTTGGTGATCAAA

AGCTTGTGGAAAGACTCCATGCA - UNI38363 - GTTTTAAAACCATTTTTGTTACGCCGGATAAAAACCGATGTAGAGAAGAGTCTGCCTCCTAAG

AAGGAAATAAAGATTTACTTGGGCCTGAGTAAAATGCAACGAGAATG - UNI38363 - GTATACAAAAATTCTGATGAAAGATATTGATGTCTTAAA

CTCTTCTGGCAAGATGGACAAGATGCGACTCTTGAATATTCTGATGCAGCTCCGAAAGTGTTGTAATCATCCTTATCTGTTTGATGGAGCAGAGCCTGGT

CCACCTTATACGACAGATGAGCACATTGTCGGCAATAGTGGTAAAATGGTCGCTCTGGATAAGCTATTGGCGAGAATTAAAGAACAGG GATCAAGAGTT

CTCATCTTTAGCCAGATGACTCGACTGTTAGACATTTTGGAGGATTATTGTATGTGGCGTGGTTATGAGTATTCTCGACTGGATGGACAAACCCCACATG

AAGAAAGAGAG GAAGCGATAGATGCCTTCAATGCTCCAAATAGCAGCAAATTCATCTTTATGCTGAGTACTAGGGCTGGAGGACTCGGAATTAACTTGG

CAAGTGCTGATGTGGTCATCCTATATGATTCAGACTGGAATCCACAGGTTGATTTACAAGCTATG GATCGGGCACATCGCATTGGTCAGAAGAAGCCAG

TACGAGTCTTCCGTCTCATTACAGACAACACAGTGGAAGAGAGGATTGTAGAAAGAGCTGAGATAAAACTGAGACTTGATTCAATTGTTATACAGCAAG 

GAAGACTCATTGACCAACAATCTAACAAGCTGGCAAAAGAGGAAATGCTACAAATGATCCGTCATGGAGCTACACATGTTTTTGCCTGTAAAGAAAGTGA

GCTGACAGATGAGGACATTGTAACTATTCTGGAAAGAGGAGAAAAGAAG ACTGCAGAGATGAATGAACGCATGCAGAAAATGGGAGAGTCATCTCTAAG

AAATTTTAGAATGGACCTTGAACAAAGTTTGTACAAGTTTGAAGGAGAAGATTACAGAGAAAAACAAAAG CTGGGTACAGTGGAATGGATTGAACCTCC

TAAACGAGAACGCAAAGCCAACTATGCAGTGGATGCCTACTTTAGAGAGGCTTTACGTGTCAGCGAGCCAAAGATCCCAAAG GCTCCTCGGCCTCCAAA

ACAGCCAAATGTTCAAGATTTTCAATTTTTTCCACCGCGCTTATTTGAGCTCCTGGAAAAGGAAATTCTTTATTATCGGAAGACTATAGGTTACAAG GT

CCCAAGAAATCCTGAGATCCCCAACCCAGCTATAGCTCAAAGAGAAGAGCAAAAAAAGATTGATGGAGCGGAACCTCTTACACCACAAGAGACTGAAGAG

AAGGATAAACTTCTCACACAA GGTTTCACAAACTGGACTAAGCGAGATTTTAACCAGTTTATTAAAGCTAATGAGAAGTATGGGAGAGATGACATTGAT

AATATAGCTCGAGAGGTGGAGGGCAAGTCCCCTGAGGAGGTCATGGAGTATTCAG CTGTATTTTGGGAACGCTGCAATGAATTACAGGACATTGAGAAA

ATTATGGCTCAAATTGAACGTGGAGAAGCAAGAATTCAGCGAAGGATCAGTATTAAGAAAGCACTGGATGCCAAA ATTGCAAGATACAAGGCTCCATTT

CATCAGTTGCGTATTCAGTATGGAACCAGTAAAGGAAAGAACTATACTGAAGAGGAAGACAGATTCTTGATCTGTATGTTACACAAAATGGGTTTTGACA

GAGAAAATGTATATGAAGAATTAAGGCAGTGTGTACGGAATGCTCCCCAGTTTAGATTTGACTGGTTCATCAAGTCGAGAACTGCCATG GAATTTCAGA

GACGCTGTAATACTTTGATTTCATTGATTGAAAAAGAAAATATGGAAATTGAGGAAAGAGAGAGAGCAGAAAAGAAGAAACGGGCAACTAAAACTCCAAT

G TCACAGAAAAGAAAAGCAGAGTCAGCTACTGAGAGCTCTGGAAGGAAGGATGTCAAGAAGGTGAAATCCTAAAGCCTAGAAATAAAGTTTTAAATGGG

AAACTGCTATTTTCTTGTCCCCATCTTCAAATGCTAATTACTACTTCCAGTGTATTCATGGTACTCTAAGGAAAAAAAAAAGGAATACTCTTTGGTTTTG

ATTTCTTGCATATTTTATATATTTTACAATGCTTTCTACCTGAAATGTGTAGCTTTCTATTTTATGCATTCTAGTATTTTCTGTACTGTATTTTGTGCAT

TTCATGTCTTCATCAAATTCCTCTCAGTCCTTGTTTTTTTGAAGCTTGTGCTGAGGTTTTAGCTTTTCTATGTTTTCTATGCCGCTGCTTTGAAAGAGAA

CCTAGATTCTATAGCTGTATTATTGTTGTTTCAGACTTTACATTTATATGGCTGTGGACAAAATGAATTAAAACGATTTGAGGAGAAAGACTTTCTCACT

TCTTTGTTGCTTTCTTTTCTATGGAGTCTGGGTTTGTGTGTGTGTAACTGCATACTGTGATTAGCATAATCATTGTTTCTTTGAGGTCATCTACATACTT

TTTCCTAAGGAAATAAAGGGTAAGAAAGAAAAAATCTTAAAAATAAACCCTAATATTTGATACTGTGTTTGCTGTCAGTGTGCGTTACATTTAAATTATT

CTCTAAATATTCAAGTGGGAAAAATATAATAAAGGACTGTCTATAAGAAATAT
Translation
MEPDTATEAATVAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKE KITSPFQLKLAAKASKSEKEMDPEYEEKMVNMPL KADRAKR

FEFLLKQTELFAHFIQPSAQKSPTSPLNMKLARPRVKKDDKQSLISVGD DYRHRRTEQEEDEELLSESRKTSNVCVRFEVSPSY YVKGGPLRDYQIRG

LNWLISLYENGVNGILADEM GLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVR AAFIRDEMMPGEWDVCVT

SYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSK LSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAD - UNI38363 - DFDSWFD

TKNCLGDQKLVERLHA - UNI38363 - VLKPFLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREW - UNI38363 - WYTKILMKDIDVLNSSGKM

DKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQG GSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEERE

 EAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAM DRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQG G

RLIDQQSNKLAKEEMLQMIRHGATHVFACKESELTDEDIVTILERGEKK TAEMNERMQKMGESSLRNFRMDLEQSLYKFEGEDYREKQK LGTVEWIEP

PKRERKANYAVDAYFREALRVSEPKIPK APRPPKQPNVQDFQFFPPRLFELLEKEILYYRKTIGYK VPRNPEIPNPAIAQREEQKKIDGAEPLTPQET

EEKDKLLTQ GFTNWTKRDFNQFIKANEKYGRDDIDNIAREVEGKSPEEVMEYSA AVFWERCNELQDIEKIMAQIERGEARIQRRISIKKALDAK IAR

YKAPFHQLRIQYGTSKGKNYTEEEDRFLICMLHKMGFDRENVYEELRQCVRNAPQFRFDWFIKSRTAM EFQRRCNTLISLIEKENMEIEERERAEKKKR

ATKTPM SQKRKAESATESSGRKDVKKVKS

For any suggestions or comments, please send an email to unitrap@crg.es