Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031133 (Arhgef6)
Chromosomal location
Chr X: 54484664 - 54591906 (-)
Description
Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6 Gene [Source:MGI (curated);Acc:Arhgef6-001]
RefSeq_dna
NM_152801 
RefSeq_peptide
NP_690014.1 
UniGene
Mm.261443 
MGI
MGI:1920591 
Uniprot/SWISSPROT
Q8K4I3 
Uniprot/SPTREMBL
A2AFJ8 A2AFI0 
Human Ortholog
ENSG00000129675 (ARHGEF6)
Omim 300436 - MENTAL RETARDATION, X-LINKED 46  
UniTrap UNI19473
Vector Insertion
Chr X: 54591514 - 54591907
Public Clones not available
Private Clones OST390613 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114735
Sequence
ATGCTTTGCCTT GTGTTACAGAACATCTTGGACACTGAAAAAGAATATGCCAAAGAACTTCAGTCTCTTCTTGTTACTTACCTAAGACCCTTGCAGTCT

AATAACAA CCTGAGTACTGTGGAGTTTACATGTTTATTGGGAAACTTTGAAGAAGTATGCACATTTCAACAGACACTCTGCCAAGCCTTGGAAGAATGT

TCAAA GTTTCCAGAAAACCAACACAAAGTAGGAGGCTGCCTACTGAACCTCATGCCTCATTTCAAATCGATGTACCTGGCTTACTGTGCAAATCATCCA

TCAGCTGTCAACGTGCTCACCCAGCACAG TGATGATCTAGAACGATTCATGGAAAATCAAGGTGCATCCAGCCCGGGTATCCTCATTCTAACAACAAGT

CTCAGCAAACCATTCATGCGACTGGAAAAGTATGTTACTCTCTTGCAAGAACTGGAACGACATATGGAG GACACTCATCCAGACCATCAGGATATTCTG

AAAGCAATCATAGCATTCAAAACACTCATG GGGCAGTGTCAAGATCTGAGAAAGAGAAAGCAGCTGGAATTGCAGATCCTTTCAGAACCTATTCAGGCA

TGGGAAGGAGATGATATTAAGACTTTGGGAAATGTGATCTTTATGTCTCAAGTAGTGATGCAGCATGGGGCCTGTGAG GAGAAAGAGGAACGATATTTT

CTGCTGTTTTCAAGTGTCTTGATAATGTTGTCTGCAAGTCCTCGGATGAGTGGCTTTATGTATCAG GGAAAAATACCAATAGCAGGGATGGTAGTGAAC

AGATTGGATGAAATTGAAGGCAGTGACTGTATGTTCGAAATCACAG GTAGCACGGTTGAGAGAATTGTGGTCCATTGCAACAATAACCAGGACTTCCAG

GAGTGGATGGAGCAGCTGAACAGACTGACCAAAGGACCAACCTCTTGCGGTTCATTGTCTAAGACCTCCTCCTCATCATGTAGTACTCATTCT GAATCT

AGTAAGAGCCCCAAAACAATGAAGAAGTTTCTTCACAAAAGAAAGACGGAGAGGAAAGCATCCGAGGAAGAATACGTGATTAGGAAAA GTACTGCTGCC

CTGGAAGAGGATGCTCAGATTCTTAAGGTGATCGAAGCTTATTGCACCAGCGCCAGTTTTCAACAAG GTACTCGTAAAGATTCTGTTCCACAAGTTCTA

CTCCCCGAGGAAGAGAAACTCATTATTGAAGAAACCAGAAGTAATGGGCAGACCATCATTGAAGAGAA GAGCCTTGTTGATACTGTCTATGCCTTGAAG

GATGAGGTCAAGGAACTGAAGCAG GAGAATAAAAAAATGAAGCAATGTCTGGAAGAAGAATTGAAGTCGAGGAAGGACCTAGAGAAGCTGGTCCGGAAG

CTGTTGAAACAAACAGATGAATGCATTCGATCTGAATCCAGCAGCAAGACCTCGATTCTCCAGTAACCATCACTGTGCAGCTGAGCACAGTGCCTTCAGC

ACTCCTTAAAGTGGCCAGCTGAATGGTTTCACTGTGCATTTGAGCTTTGTGCTTTGTGGTGTTGGGATGCTCTCTCTTTCTTCCTCTCTCCCTTCCCCTC

CCCCTTCCCCCTCCACTGTTTGATTCAGAGTTTATTGCTTGGTTATCAGTTGATTGACACTTGTTTTAACAGGGGGAAATAGCCTGACGTGGTGGCCAAA

ATGGCCCCAATACTTTGCTATGCCCAACAGCCCTTTACTACCTAATTCGCTGGAGGCTAAGCTTCTCAGGCTATGTATAGAGTAGGTGAAAATGAACACC

TTTGCCCAGTGACCCAGTTGCACTTCCCTTTACTATCATATGGCCCCCTTCAGTACTTTAAGAACTTATTGCCCATGTTGTCTGTTGAGATCAAGAACAG

TGTAGTGCCCTTATGCCCTCTGCCCTCTGTGCTGTTGTCCATTTAAAGTCAGTGTGGTAGGAACTCCAACCATCCACACCAGCACCAAGTCTCTCAGCAA

ATTGCTTCAGGCAGTCCTCCGTCAGCAGCAGGGCAAAGCAGCTTGATGGAGTACTTATCCCTAGTATAGCGTAGCTTTACAGCCCAGCCCTCTGCCTCTA

TGTAAGTTTTCTACCTCCCCTCAACCCCATGCTTTTAGCCAGCCATACAAAGTGGGGTGTCAATGATCATGGATTTGCTTTGCTTATCTTGTCAGTTACT

GTGAGCAATGACTTTACTTTGAATATTCCCATGACAACCTTTTCACCTTTCTAAACAACTTGGGTGAGAAAATATTGTGCCCTCGTACACCTTCCATCCC

ATCTCACCAAGCTCTGGTTTCTGCAATGAGAAGTTGGACTCATCAGTGGCCTCTAGGATGATGATCCAGATTATAGACCCTGAGTTAAAGGGCCCCTCCT

AGCTGGAGCAGGCTGTCAGTGAAGCTGACTATTTGAAACTAGTTTGTTCAAGTTGTTTATAATGTCAAACCATTGACTTTGTATGTGGTCCAGAAAAGTG

ACCCGTGAGAAAGCAGATTTCACAGAGAGCCCCAGAAGAACACTGTATACCTAAATTCAACACAAGTCAAAATGGGCTGAGGATGGAGGAACACAGCTCT

CACCTACCTCCTCAGATGACAGCACAACTTGGCCAGATGGCAAAGTCACTGGAAAAAGATGCAGAAAGCCAACCAAAGGCTTACGTGTATATTATTTGAT

TGGGCCCTGTAAGGGTTGTTTCAAAACCAACCTTGAGGCCTAAAAGCTTGTTGAGGAGCCCTTTTCCTTTGTGATATGGAGGCTCTCACAGTTTCCATAA

CTTTATGGTACAGTGCTATTATCTCATGTTACATGGCCAACATTATAGCACCCACAGGATGTGGAGTATTCCTAAAGGCCAACCTCAGACAATCGCATAG

AGCTATCTTTGTCAGCTTAGAGAGTAAAGGTTGCTAAGAACAGCTGTCCTGTTTCTAAGCCCAGAGATTTCTATGAGACATCTTTCATGTAAAACATTTT

TACAAAAGGAATAACAGTAGCAACCCACATGTTCCCATTTGTCCTGTCTGTGCTTGGTCAATAGTTGGCAATCAATGTGCAAAATTTGTCCATAGGAAAA

ACCACTTTTGTGGTCGCCAAATAATTTAGTTCATTGCTTAAGACATTGAAAGGTCTCATAAAGGATGTGTACATATGCATGTTTGGGGACTTTGCCCTTA

TGAGGAGAGGCCCTTGGTACTCTGGATAAGGAAACTTGTGCAGTGGGCTGCCCATGCTTACACACTAAATAATATAAAGGAAATGAAGCCATGTTAACTC

CACAGTCATGTCTCCATAGTTGTGTTGTTTACAATACTCTGGAAGTAAACTGCTGCCCTTAGGGGCCTTTCAGTTTCCCCTCTGTTATGTCCCTTCTTAT

AGGAGCTCAGATTTTCTAAACTTGTTTTTATTTTAAAGACTTTTAAAATGGACATTTTCAATAAACAAGAATAAACAGTGCTTTATAAAT
Translation
MLCL VLQNILDTEKEYAKELQSLLVTYLRPLQSNNN NLSTVEFTCLLGNFEEVCTFQQTLCQALEECSK KFPENQHKVGGCLLNLMPHFKSMYLAYC

ANHPSAVNVLTQHS SDDLERFMENQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHME DTHPDHQDILKAIIAFKTLM GQCQDLRKRKQLELQI

LSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACE EKEERYFLLFSSVLIMLSASPRMSGFMYQ GKIPIAGMVVNRLDEIEGSDCMFEITG GSTVERIV

VHCNNNQDFQEWMEQLNRLTKGPTSCGSLSKTSSSSCSTHS ESSKSPKTMKKFLHKRKTERKASEEEYVIRKS STAALEEDAQILKVIEAYCTSASFQ

QG GTRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEK KSLVDTVYALKDEVKELKQ ENKKMKQCLEEELKSRKDLEKLVRKLLKQTDECIRSESSSKT

SILQ
Transcript ENSMUST00000114736
Sequence
GGAGTTTGTCCATTCCTTATCATTCCTTTCCATATCTTTAGGTATGATCTCTGTGGTTTAGAAATCCCACGTTCCTCTGTTGTCAGAGAAAAGTTGCCTT

AAACCTTTGCCCCGCAAGCACCAGAAGAGCGCTCATAAAAGGAAGACAGCAGCAGATGCAATCACGGATGTGGCTTAGTCTTCACAGCTGCCCCGAGAGC

TGTTCAGAGCGTCCGAGAGCCTCAGTCATGAATCCAGAAGAACGCCTTGTGACATGGCTTATATCTTTGGGAGTTCTAGAGTCTCCCAAAAAGACTGTCT

GTGATCCAGAGGAGTTCTTGAAGTCCTCGCTGAAAAATGGGGTAGTGTTGTGCAAACTCATAAACAGACTTCTGCCTGGCTCGGTGGAGAAG - UNI19

473 - TATTGTCTGGAACCCCAAACTGAGGCCGACTGCATCGACAACATCAATGACTTCCTGAAAGGATGTGCAACTCTTCAAGTGGAA GTGTTTGAG

CCTGATGACCTCTATTCGGGGGCCAATTTCTCCAAGGTTCTGAATACTCTTTTAGCTGTCAACAAAGCAACTGAAG ATCAGCTCTCAGAAAGACCATGT

GGAAGGTCCTCTTCTCTTAGTGCTGCGACCAGCTCTCAGACAAACCCGCAGGTGGCCGTTCCCAGCACAGCTCCAGAGCAGCACAGCGAGGAAAAGGCA 

GAGATGACGGAAAATGGAAGTCACCAGTTGATAGTAAAGGCAAGATTCAACTTCAAGCAGACGAATGAAGATGAATTGTCAGTGTGTAAAGGGGACATCA

TTTATGTCACACGAGTTGAAGAAGGAGGCTGGTGGGAAGGCACATTAAATGGGAGAACTGGATGGTTCCCTAGTAATTATGTCCGAGAAATTAAACCCAG

TG AGAGACCTCTGTCCCCTAAGGCTATCAAAGGATTTGACACTGCTCCACTTACCAAGAATTACTACACTGTG GTGTTACAGAACATCTTGGACACTG

AAAAAGAATATGCCAAAGAACTTCAGTCTCTTCTTGTTACTTACCTAAGACCCTTGCAGTCTAATAACAA CCTGAGTACTGTGGAGTTTACATGTTTAT

TGGGAAACTTTGAAGAAGTATGCACATTTCAACAGACACTCTGCCAAGCCTTGGAAGAATGTTCAAA GTTTCCAGAAAACCAACACAAAGTAGGAGGCT

GCCTACTGAACCTCATGCCTCATTTCAAATCGATGTACCTGGCTTACTGTGCAAATCATCCATCAGCTGTCAACGTGCTCACCCAGCACAG TGATGATC

TAGAACGATTCATGGAAAATCAAGGTGCATCCAGCCCGGGTATCCTCATTCTAACAACAAGTCTCAGCAAACCATTCATGCGACTGGAAAAGTATGTTAC

TCTCTTGCAAGAACTGGAACGACATATGGAG GACACTCATCCAGACCATCAGGATATTCTGAAAGCAATCATAGCATTCAAAACACTCATG GGGCAGT

GTCAAGATCTGAGAAAGAGAAAGCAGCTGGAATTGCAGATCCTTTCAGAACCTATTCAGGCATGGGAAGGAGATGATATTAAGACTTTGGGAAATGTGAT

CTTTATGTCTCAAGTAGTGATGCAGCATGGGGCCTGTGAG GAGAAAGAGGAACGATATTTTCTGCTGTTTTCAAGTGTCTTGATAATGTTGTCTGCAAG

TCCTCGGATGAGTGGCTTTATGTATCAG GGAAAAATACCAATAGCAGGGATGGTAGTGAACAGATTGGATGAAATTGAAGGCAGTGACTGTATGTTCGA

AATCACAG GTAGCACGGTTGAGAGAATTGTGGTCCATTGCAACAATAACCAGGACTTCCAGGAGTGGATGGAGCAGCTGAACAGACTGACCAAAGGACC

AACCTCTTGCGGTTCATTGTCTAAGACCTCCTCCTCATCATGTAGTACTCATTCT TCTTTTAGCTCTACCGGACAGCCCCGAGGACCCTTGGAGCCTCC

TCAAATTATAAAACCGTGGAGTTTAAGTTGCCTACGACCTGCACCTCCACTTAGACCATCAGCAGCACTAGGTTATAAAGAG AGGATGTCTTATATCTT

AAAG GAATCTAGTAAGAGCCCCAAAACAATGAAGAAGTTTCTTCACAAAAGAAAGACGGAGAGGAAAGCATCCGAGGAAGAATACGTGATTAGGAAAA 

GTACTGCTGCCCTGGAAGAGGATGCTCAGATTCTTAAGGTGATCGAAGCTTATTGCACCAGCGCCAGTTTTCAACAAG GTACTCGTAAAGATTCTGTTC

CACAAGTTCTACTCCCCGAGGAAGAGAAACTCATTATTGAAGAAACCAGAAGTAATGGGCAGACCATCATTGAAGAGAA GAGCCTTGTTGATACTGTCT

ATGCCTTGAAGGATGAGGTCAAGGAACTGAAGCAG GAGAATAAAAAAATGAAGCAATGTCTGGAAGAAGAATTGAAGTCGAGGAAGGACCTAGAGAAGC

TGGTCCGGAAGCTGTTGAAACAAACAGATGAATGCATTCGATCTGAATCCAGCAGCAAGACCTCGATTCTCCAGTAACCATCACTGTGCAGCTGAGCACA

GTGCCTTCAGCACTCCTTAAAGTGGCCAGCTGAATGGTTTCACTGTGCATTTGAGCTTTGTGCTTTGTGGTGTTGGGATGCTCTCTCTTTCTTCCTCTCT

CCCTTCCCCTCCCCCTTCCCCCTCCACTGTTTGATTCAGAGTTTATTGCTTGGTTATCAGTTGATTGACACTTGTTTTAACAGGGGGAAATAGCCTGACG

TGGTGGCCAAAATGGCCCCAATACTTTGCTATGCCCAACAGCCCTTTACTACCTAATTCGCTGGAGGCTAAGCTTCTCAGGCTATGTATAGAGTAGGTGA

AAATGAACACCTTTGCCCAGTGACCCAGTTGCACTTCCCTTTACTATCATATGGCCCCCTTCAGTACTTTAAGAACTTATTGCCCATGTTGTCTGTTGAG

ATCAAGAACAGTGTAGTGCCCTTATGCCCTCTGCCCTCTGTGCTGTTGTCCATTTAAAGTCAGTGTGGTAGGAACTCCAACCATCCACACCAGCACCAAG

TCTCTCAGCAAATTGCTTCAGGCAGTCCTCCGTCAGCAGCAGGGCAAAGCAGCTTGATGGAGTACTTATCCCTAGTATAGCGTAGCTTTACAGCCCAGCC

CTCTGCCTCTATGTAAGTTTTCTACCTCCCCTCAACCCCATGCTTTTAGCCAGCCATACAAAGTGGGGTGTCAATGATCATGGATTTGCTTTGCTTATCT

TGTCAGTTACTGTGAGCAATGACTTTACTTTGAATATTCCCATGACAACCTTTTCACCTTTCTAAACAACTTGGGTGAGAAAATATTGTGCCCTCGTACA

CCTTCCATCCCATCTCACCAAGCTCTGGTTTCTGCAATGAGAAGTTGGACTCATCAGTGGCCTCTAGGATGATGATCCAGATTATAGACCCTGAGTTAAA

GGGCCCCTCCTAGCTGGAGCAGGCTGTCAGTGAAGCTGACTATTTGAAACTAGTTTGTTCAAGTTGTTTATAATGTCAAACCATTGACTTTGTATGTGGT

CCAGAAAAGTGACCCGTGAGAAAGCAGATTTCACAGAGAGCCCCAGAAGAACACTGTATACCTAAATTCAACACAAGTCAAAATGGGCTGAGGATGGAGG

AACACAGCTCTCACCTACCTCCTCAGATGACAGCACAACTTGGCCAGATGGCAAAGTCACTGGAAAAAGATGCAGAAAGCCAACCAAAGGCTTACGTGTA

TATTATTTGATTGGGCCCTGTAAGGGTTGTTTCAAAACCAACCTTGAGGCCTAAAAGCTTGTTGAGGAGCCCTTTTCCTTTGTGATATGGAGGCTCTCAC

AGTTTCCATAACTTTATGGTACAGTGCTATTATCTCATGTTACATGGCCAACATTATAGCACCCACAGGATGTGGAGTATTCCTAAAGGCCAACCTCAGA

CAATCGCATAGAGCTATCTTTGTCAGCTTAGAGAGTAAAGGTTGCTAAGAACAGCTGTCCTGTTTCTAAGCCCAGAGATTTCTATGAGACATCTTTCATG

TAAAACATTTTTACAAAAGGAATAACAGTAGCAACCCACATGTTCCCATTTGTCCTGTCTGTGCTTGGTCAATAGTTGGCAATCAATGTGCAAAATTTGT

CCATAGGAAAAACCACTTTTGTGGTCGCCAAATAATTTAGTTCATTGCTTAAGACATTGAAAGGTCTCATAAAGGATGTGTACATATGCATGTTTGGGGA

CTTTGCCCTTATGAGGAGAGGCCCTTGGTACTCTGGATAAGGAAACTTGTGCAGTGGGCTGCCCATGCTTACACACTAAATAATATAAAGGAAATGAAGC

CATGTTAACTCCACAGTCATGTCTCCATAGTTGTGTTGTTTACAATACTCTGGAAGTAAACTGCTGCCCTTAGGGGCCTTTCAGTTTCCCCTCTGTTATG

TCCCTTCTTATAGGAGCTCAGATTTTCTAAACTTGTTTTTATTTTAAAGACTTTTAAAATGGACATTTTCAATAAACAAGAATAAACAGTGCTTTATAAA

T
Translation
MNPEERLVTWLISLGVLESPKKTVCDPEEFLKSSLKNGVVLCKLINRLLPGSVEK - UNI19473 - YCLEPQTEADCIDNINDFLKGCATLQVE VF

EPDDLYSGANFSKVLNTLLAVNKATED DQLSERPCGRSSSLSAATSSQTNPQVAVPSTAPEQHSEEKA EMTENGSHQLIVKARFNFKQTNEDELSVCK

GDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKPSE ERPLSPKAIKGFDTAPLTKNYYTV VLQNILDTEKEYAKELQSLLVTYLRPLQSNNN NLS

TVEFTCLLGNFEEVCTFQQTLCQALEECSK KFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHS SDDLERFMENQGASSPGILILTTSLS

KPFMRLEKYVTLLQELERHME DTHPDHQDILKAIIAFKTLM GQCQDLRKRKQLELQILSEPIQAWEGDDIKTLGNVIFMSQVVMQHGACE EKEERYF

LLFSSVLIMLSASPRMSGFMYQ GKIPIAGMVVNRLDEIEGSDCMFEITG GSTVERIVVHCNNNQDFQEWMEQLNRLTKGPTSCGSLSKTSSSSCSTHS

 SFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKE RMSYILK ESSKSPKTMKKFLHKRKTERKASEEEYVIRKS STAALEEDAQILKVI

EAYCTSASFQQG GTRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEK KSLVDTVYALKDEVKELKQ ENKKMKQCLEEELKSRKDLEKLVRKLLKQTDE

CIRSESSSKTSILQ
Transcript ENSMUST00000033468
Sequence
GGAGTTTGTCCATTCCTTATCATTCCTTTCCATATCTTTAGGTATGATCTCTGTGGTTTAGAAATCCCACGTTCCTCTGTTGTCAGAGAAAAGTTGCCTT

AAACCTTTGCCCCGCAAGCACCAGAAGAGCGCTCATAAAAGGAAGACAGCAGCAGATGCAATCACGGATGTGGCTTAGTCTTCACAGCTGCCCCGAGAGC

TGTTCAGAGCGTCCGAGAGCCTCAGTCATGAATCCAGAAGAACGCCTTGTGACATGGCTTATATCTTTGGGAGTTCTAGAGTCTCCCAAAAAGACTGTCT

GTGATCCAGAGGAGTTCTTGAAGTCCTCGCTGAAAAATGGGGTAGTGTTGTGCAAACTCATAAACAGACTTCTGCCTGGCTCGGTGGAGAAG - UNI19

473 - TATTGTCTGGAACCCCAAACTGAGGCCGACTGCATCGACAACATCAATGACTTCCTGAAAGGATGTGCAACTCTTCAAGTGGAA GTGTTTGAG

CCTGATGACCTCTATTCGGGGGCCAATTTCTCCAAGGTTCTGAATACTCTTTTAGCTGTCAACAAAGCAACTGAAG ATCAGCTCTCAGAAAGACCATGT

GGAAGGTCCTCTTCTCTTAGTGCTGCGACCAGCTCTCAGACAAACCCGCAGGTGGCCGTTCCCAGCACAGCTCCAGAGCAGCACAGCGAGGAAAAGGCA 

GAGATGACGGAAAATGGAAGTCACCAGTTGATAGTAAAGGCAAGATTCAACTTCAAGCAGACGAATGAAGATGAATTGTCAGTGTGTAAAGGGGACATCA

TTTATGTCACACGAGTTGAAGAAGGAGGCTGGTGGGAAGGCACATTAAATGGGAGAACTGGATGGTTCCCTAGTAATTATGTCCGAGAAATTAAACCCAG

TG AGAGACCTCTGTCCCCTAAGGCTATCAAAGGATTTGACACTGCTCCACTTACCAAGAATTACTACACTGTG GTGTTACAGAACATCTTGGACACTG

AAAAAGAATATGCCAAAGAACTTCAGTCTCTTCTTGTTACTTACCTAAGACCCTTGCAGTCTAATAACAA CCTGAGTACTGTGGAGTTTACATGTTTAT

TGGGAAACTTTGAAGAAGTATGCACATTTCAACAGACACTCTGCCAAGCCTTGGAAGAATGTTCAAA GTTTCCAGAAAACCAACACAAAGTAGGAGGCT

GCCTACTGAACCTCATGCCTCATTTCAAATCGATGTACCTGGCTTACTGTGCAAATCATCCATCAGCTGTCAACGTGCTCACCCAGCACAG TGATGATC

TAGAACGATTCATGGAAAATCAAGGTGCATCCAGCCCGGGTATCCTCATTCTAACAACAAGTCTCAGCAAACCATTCATGCGACTGGAAAAGTATGTTAC

TCTCTTGCAAGAACTGGAACGACATATGGAG GACACTCATCCAGACCATCAGGATATTCTGAAAGCAATCATAGCATTCAAAACACTCATG GGGCAGT

GTCAAGATCTGAGAAAGAGAAAGCAGCTGGAATTGCAGATCCTTTCAGAACCTATTCAGGCATGGGAAGGAGATGATATTAAGACTTTGGGAAATGTGAT

CTTTATGTCTCAAGTAGTGATGCAGCATGGGGCCTGTGAG GAGAAAGAGGAACGATATTTTCTGCTGTTTTCAAGTGTCTTGATAATGTTGTCTGCAAG

TCCTCGGATGAGTGGCTTTATGTATCAG GGAAAAATACCAATAGCAGGGATGGTAGTGAACAGATTGGATGAAATTGAAGGCAGTGACTGTATGTTCGA

AATCACAG GTAGCACGGTTGAGAGAATTGTGGTCCATTGCAACAATAACCAGGACTTCCAGGAGTGGATGGAGCAGCTGAACAGACTGACCAAAGGACC

AACCTCTTGCGGTTCATTGTCTAAGACCTCCTCCTCATCATGTAGTACTCATTCT TCTTTTAGCTCTACCGGACAGCCCCGAGGACCCTTGGAGCCTCC

TCAAATTATAAAACCGTGGAGTTTAAGTTGCCTACGACCTGCACCTCCACTTAGACCATCAGCAGCACTAGGTTATAAAGAG GAATCTAGTAAGAGCCC

CAAAACAATGAAGAAGTTTCTTCACAAAAGAAAGACGGAGAGGAAAGCATCCGAGGAAGAATACGTGATTAGGAAAA GTACTGCTGCCCTGGAAGAGGA

TGCTCAGATTCTTAAGGTGATCGAAGCTTATTGCACCAGCGCCAGTTTTCAACAAG GTACTCGTAAAGATTCTGTTCCACAAGTTCTACTCCCCGAGGA

AGAGAAACTCATTATTGAAGAAACCAGAAGTAATGGGCAGACCATCATTGAAGAGAA GAGCCTTGTTGATACTGTCTATGCCTTGAAGGATGAGGTCAA

GGAACTGAAGCAG GAGAATAAAAAAATGAAGCAATGTCTGGAAGAAGAATTGAAGTCGAGGAAGGACCTAGAGAAGCTGGTCCGGAAGCTGTTGAAACA

AACAGATGAATGCATTCGATCTGAATCCAGCAGCAAGACCTCGATTCTCCAGTAACCATCACTGTGCAGCTGAGCACAGTGCCTTCAGCACTCCTTAAAG

TGGCCAGCTGAATGGTTTCACTGTGCATTTGAGCTTTGTGCTTTGTGGTGTTGGGATGCTCTCTCTTTCTTCCTCTCTCCCTTCCCCTCCCCCTTCCCCC

TCCACTGTTTGATTCAGAGTTTATTGCTTGGTTATCAGTTGATTGACACTTGTTTTAACAGGGGGAAATAGCCTGACGTGGTGGCCAAAATGGCCCCAAT

ACTTTGCTATGCCCAACAGCCCTTTACTACCTAATTCGCTGGAGGCTAAGCTTCTCAGGCTATGTATAGAGTAGGTGAAAATGAACACCTTTGCCCAGTG

ACCCAGTTGCACTTCCCTTTACTATCATATGGCCCCCTTCAGTACTTTAAGAACTTATTGCCCATGTTGTCTGTTGAGATCAAGAACAGTGTAGTGCCCT

TATGCCCTCTGCCCTCTGTGCTGTTGTCCATTTAAAGTCAGTGTGGTAGGAACTCCAACCATCCACACCAGCACCAAGTCTCTCAGCAAATTGCTTCAGG

CAGTCCTCCGTCAGCAGCAGGGCAAAGCAGCTTGATGGAGTACTTATCCCTAGTATAGCGTAGCTTTACAGCCCAGCCCTCTGCCTCTATGTAAGTTTTC

TACCTCCCCTCAACCCCATGCTTTTAGCCAGCCATACAAAGTGGGGTGTCAATGATCATGGATTTGCTTTGCTTATCTTGTCAGTTACTGTGAGCAATGA

CTTTACTTTGAATATTCCCATGACAACCTTTTCACCTTTCTAAACAACTTGGGTGAGAAAATATTGTGCCCTCGTACACCTTCCATCCCATCTCACCAAG

CTCTGGTTTCTGCAATGAGAAGTTGGACTCATCAGTGGCCTCTAGGATGATGATCCAGATTATAGACCCTGAGTTAAAGGGCCCCTCCTAGCTGGAGCAG

GCTGTCAGTGAAGCTGACTATTTGAAACTAGTTTGTTCAAGTTGTTTATAATGTCAAACCATTGACTTTGTATGTGGTCCAGAAAAGTGACCCGTGAGAA

AGCAGATTTCACAGAGAGCCCCAGAAGAACACTGTATACCTAAATTCAACACAAGTCAAAATGGGCTGAGGATGGAGGAACACAGCTCTCACCTACCTCC

TCAGATGACAGCACAACTTGGCCAGATGGCAAAGTCACTGGAAAAAGATGCAGAAAGCCAACCAAAGGCTTACGTGTATATTATTTGATTGGGCCCTGTA

AGGGTTGTTTCAAAACCAACCTTGAGGCCTAAAAGCTTGTTGAGGAGCCCTTTTCCTTTGTGATATGGAGGCTCTCACAGTTTCCATAACTTTATGGTAC

AGTGCTATTATCTCATGTTACATGGCCAACATTATAGCACCCACAGGATGTGGAGTATTCCTAAAGGCCAACCTCAGACAATCGCATAGAGCTATCTTTG

TCAGCTTAGAGAGTAAAGGTTGCTAAGAACAGCTGTCCTGTTTCTAAGCCCAGAGATTTCTATGAGACATCTTTCATGTAAAACATTTTTACAAAAGGAA

TAACAGTAGCAACCCACATGTTCCCATTTGTCCTGTCTGTGCTTGGTCAATAGTTGGCAATCAATGTGCAAAATTTGTCCATAGGAAAAACCACTTTTGT

GGTCGCCAAATAATTTAGTTCATTGCTTAAGACATTGAAAGGTCTCATAAAGGATGTGTACATATGCATGTTTGGGGACTTTGCCCTTATGAGGAGAGGC

CCTTGGTACTCTGGATAAGGAAACTTGTGCAGTGGGCTGCCCATGCTTACACACTAAATAATATAAAGGAAATGAAGCCATGTTAACTCCACAGTCATGT

CTCCATAGTTGTGTTGTTTACAATACTCTGGAAGTAAACTGCTGCCCTTAGGGGCCTTTCAGTTTCCCCTCTGTTATGTCCCTTCTTATAGGAGCTCAGA

TTTTCTAAACTTGTTTTTATTTTAAAGACTTTTAAAATGGACATTTTCAATAAACAAGAATAAACAGTGCTTTATAAAT
Translation
MQSRMWLSLHSCPESCSERPRASVMNPEERLVTWLISLGVLESPKKTVCDPEEFLKSSLKNGVVLCKLINRLLPGSVEK - UNI19473 - YCLEPQT

EADCIDNINDFLKGCATLQVE VFEPDDLYSGANFSKVLNTLLAVNKATED DQLSERPCGRSSSLSAATSSQTNPQVAVPSTAPEQHSEEKA EMTENG

SHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKPSE ERPLSPKAIKGFDTAPLTKNYYTV VLQNILDTEKEY

AKELQSLLVTYLRPLQSNNN NLSTVEFTCLLGNFEEVCTFQQTLCQALEECSK KFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHS SD

DLERFMENQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHME DTHPDHQDILKAIIAFKTLM GQCQDLRKRKQLELQILSEPIQAWEGDDIKTLG

NVIFMSQVVMQHGACE EKEERYFLLFSSVLIMLSASPRMSGFMYQ GKIPIAGMVVNRLDEIEGSDCMFEITG GSTVERIVVHCNNNQDFQEWMEQLN

RLTKGPTSCGSLSKTSSSSCSTHS SFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKE ESSKSPKTMKKFLHKRKTERKASEEEYVIRKS

 STAALEEDAQILKVIEAYCTSASFQQG GTRKDSVPQVLLPEEEKLIIEETRSNGQTIIEEK KSLVDTVYALKDEVKELKQ ENKKMKQCLEEELKSR

KDLEKLVRKLLKQTDECIRSESSSKTSILQ

For any suggestions or comments, please send an email to unitrap@crg.es