Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031134 (Rbmx)
Chromosomal location
Chr X: 54639207 - 54646213 (-)
Description
RNA binding motif protein, X chromosome Gene [Source:MGI (curated);Acc:Rbmx-004]
RefSeq_dna
NM_011252 
RefSeq_peptide
NP_035382.1 
UniGene
Mm.28275 Mm.474962 
MGI
MGI:1343044 
Uniprot/SPTREMBL
A2AFI3 A2AFI4 Q8C2U6 Q9R0Y0 Q9WV02 
Human Ortholog
ENSG00000147274 (RBMX)
Omim not available
UniTrap UNI29561
Vector Insertion
Chr X: 54644743 - 54646140
Public Clones E326H11 (ggtc) IST14442G12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000098470
Sequence
GGTTCTTCAGCCTCGTTCCCGGGTAGTATAAAGATTGCAGTCTCCTTTGTTCGCCCTCGTTGCGCAGTCGTCCTAGCGTCATTTCTGTTCCGTTCTGAAA

ATCGGTAGCTGTCACTGGTGCGGCGCTGCTCGGGAGGTCCGGTCGGCGAGCTCAGAGGAGCTTGAGACCGTCGCAGTCCCCTCGG - UNI29561 - C

AGACCCCCATCGGTTAAGAGGAAAAATGGTTGAAGCAGATCGCCCAGGAAAGCTCTTTATTGGTGGGCTTAATACAGAGACGAATGAGAAAGCCCTTGAG

GCAGTGTTTGGCAAATATGGACGAATAGTGGAAG - UNI29561 - TTCTTTTGATGAAGGACCGAGAAACGAATAAGTCAAGAGGATTCGCTTTTGT

CACTTTTGAAAGCCCAGCAGATGCAAAGGATGCTGCCAGAGACATGAATGGAAAG TCCTTAGATGGGAAAGCCATCAAGGTGGAGCAAGCCACCAAACC

ATCATTTGAAAGTGGTAGACGTGGACTACCCCCACCTCCAAGAAGCAGAGGCCCTCCCAGAGGTCTTCGAGGAGGAAGAGGAGGAAGTGGAGGAACCAGA

GGACCCCCCTCCCGGGGAGGACACATGG ATGATGGTGGCTACTCCATGAATTTTACCATGAGTTCTTCCAGAGGACCTCTGCCAGTAAAACGAGGACCA

CCACCACGAAGTGGAGGTCCTCCTCCTAAAAGATCAGCACCTTCTGGACCAGTTCGTAGCAGCAGTGGACTGGGAGGAAGAG CCCCTGTGTCCCGTGGA

AGAGATGGTTACGGAGGCCCGCCACGAAGGGAGCCCCTGCCTTCTCGAAGAGATGTTTATTTGTCCCCGAGAGATGATGGATATTCCACTAAAGACAG C

TATTCAAGCAGAGAATATCCAAGTTCTCGAGATACACGAGATTATGCACCACCACCAAGAGATTATACTTACCGTGATTATGGTCATTCCAGTTCACGAG

ATGACTATCCATCAAGAGGCTATAG TGATAGAGATGGCTATGGTCGGGATCGGGACTATTCAGATCATCCAAGTGGAGGTTCCTACAGAGATTCGTATG

AGAGTTATGGTAAGATACCGGTTAAGGATCTTAAACTATCACCAGCTTGAGGTTTTAGGTTCATGAGCTGGATTAATAGGCTGCGTGGTGCTTGCTTTTA

AAGGGACATTTGCTTGCTTTCAAGGGGTAACTTTATCAGCTGGGCTTTTCCTAGTTTTGTGAAGGGTGTTTTGGTTCTTTCCTTGTTTTGTTTTTTGTTT

GTTTGTTGTTTTGTTTTGTTTTTACTTTTGAGGCTGTTCGCTTGCTTTGGAGGGGATTTTGCTTGCTTAAATTGGCAGCCTTATGTGTTTTCCCCCCCAA

CAGTGAAAATACAATTTAAAAATTTTATTAACCAGATCAAATATTTACCATTGCAATATGAAGGAAACTCAACAGTTCAAAAATTGCAACTTATCACTGG

AAAGTGGCTGAGTGTCTACTCTAAAATAACAAGCTGTCTGGAATGTCCTCTTGAAATACACAACGTCTTCAGTCTTTTCAAACAAACATTAAAATCAATC

CGTTTCCGTACCTCAGCAGATGAGCAATTCCCTCTTATGGCCAGCAATGGTAGAGTTTAAAACTTCCCAGTTGAGAAAGTGAACTTTTAATACAAAGAAT

TCTGTAAATTCAGATTTAAATGTTGTATATATACAATTTATAGTGTTGCCATATTACCTGACCATTGACCCTGCAGGTAACTCACGTAGTGCTCCACCTA

CACGAGGGCCCCCGCCATCTTATGGTGGAAGCAGTCGCTATGATGATTACAGCAGCTCACGTGACGGATATGGTGGAAGTCGAGACAGTTACTCAAGCAG

CCGAAGTGATCTCTACTCAAGTGGTCGTGATCGCGTGGGCAGACAAGAAAGAGGGCTTCCCCCTTCTATGGAAAGGGGGTACCCTCCTCCACGTGATTCC

TACAGCAGTTCAAGCCGCGGAGCACCAAGAGGTGGTGGCCGTGGAGGAAGCCGATCTGATAGAGGGGGAGGCAGAAGCAGATACTAGGAACAAACAAAAC

TTTTGGACCAAAAAAATCCCCATTCAAAGCAACAAACAAAAGTGGAAACTTTCTGTCATAAACTACCCAAGGACTACTAAAAGGAAAAATTGTGTTACCT

TTTTAAAATTTCCTGTTCCCTTTTAATAATTTTTATGTTCTTGTGAGGGAAAAAGTAAGACGTGTTTAATTTTATTTGCTAGTATGAGCTGCTTTCAACA

AGCAAATGGTAGATGTGTGAGCCTTGACTTGTTCCTAGTGTTGTAATTTTCCAAGTGAAAGTGTCCCTGAAGGCCAGCCACTTCCTGATTTTTTTCCCCA

GTAAATGAGGCAAGCAACCCCAAGATCATCCACAAACTTCCAGCCATCTAGATGGCCTCTGGTCTCCACTGAGAGCTGAATCGCCCTGCCTGTGCAGACA

AGCTAGCCATTAGAGAGGGTTGGTTGGGTGTGCTACTTTCAGTATTTCAGGGTGTCTTCCAACTGAAATCTCAATCTTCGCAGTATATATATTAAAACCA

ACGAGCAAACCTGAGCTCCGATGCCTAGGATGTACTGTTTACCCAGAAACCCCCCAAAAAAGCAGATGGATACTGGCCATATTTTGCTTTTTTGACACTT

CCTTGGGAATCTACAAGAACCTCCCTTCCCCCTCCCCGAGTAAGACCTAAGACCATTTAAGTGTGTGTTAAACAACTACAAAATACTCAATAAAACGTTT

GGCCAAAGTCAACCCTGAAGCTGCAAACCGATGCTTGCTCTTACTGTTTCAAATTTTTGCAACTCTGTAGTGTCTCACTTTTAAAGGAACAGCTTGATTG

CAAAGGAGAAAATAGATAAGCAATGAAGTTATCTCCAACTTCCTAAAGGCTTATGACTTCTAAAAAGTGAATCTATCAGCATTCCACATCAGATTTAAAG

CACCAAATGCCCGTGAAACAGCAAAGATGGTAAGCAAAGCAAACTAGTTTTTCCGTCTAAGTCGAAATTGAGCACTTACCTTCCTCATAGTACAGTGATG

CCTACTGTACTTCCTGGCAGTGGAAATGCCTTCTAGATTT
Translation
 - UNI29561 - MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV - UNI29561 - VLLMKDRETNKSRGFAFVTFESPADAKDAARDMNG

K SLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMD DDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPS

GPVRSSSGLGGRA APVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDS SYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYS SD

RDGYGRDRDYSDHPSGGSYRDSYESYGKIPVKDLKLSPA
Transcript ENSMUST00000114726
Sequence
GGTTCTTCAGCCTCGTTCCCGGGTAGTATAAAGATTGCAGTCTCCTTTGTTCGCCCTCGTTGCGCAGTCGTCCTAGCGTCATTTCTGTTCCGTTCTGAAA

ATCGGTAGCTGTCACTGGTGCGGCGCTGCTCGGGAGGTCCGGTCGGCGAGCTCAGAGGAGCTTGAGACCGTCGCAGTCCCCTCGG - UNI29561 - C

AGACCCCCATCGGTTAAGAGGAAAAATGGTTGAAGCAGATCGCCCAGGAAAGCTCTTTATTGGTGGGCTTAATACAGAGACGAATGAGAAAGCCCTTGAG

GCAGTGTTTGGCAAATATGGACGAATAGTGGAAG - UNI29561 - TTCTTTTGATGAAGGACCGAGAAACGAATAAGTCAAGAGGATTCGCTTTTGT

CACTTTTGAAAGCCCAGCAGATGCAAAGGATGCTGCCAGAGACATGAATGGAAAG TCCTTAGATGGGAAAGCCATCAAGGTGGAGCAAGCCACCAAACC

ATCATTTGAAAGTGGTAGACGTGGACTACCCCCACCTCCAAGAAGCAGAGGCCCTCCCAGAGGTCTTCGAGGAGGAAGAGGAGGAAGTGGAGGAACCAGA

GGACCCCCCTCCCGGGGAGGACACATGG ATGATGGTGGCTACTCCATGAATTTTACCATGAGTTCTTCCAGAGGACCTCTGCCAGTAAAACGAGGACCA

CCACCACGAAGTGGAGGTCCTCCTCCTAAAAGATCAGCACCTTCTGGACCAGTTCGTAGCAGCAGTGGACTGGGAGGAAGAG CCCCTGTGTCCCGTGGA

AGAGATGGTTACGGAGGCCCGCCACGAAGGGAGCCCCTGCCTTCTCGAAGAGATGTTTATTTGTCCCCGAGAGATGATGGATATTCCACTAAAGACAG C

TATTCAAGCAGAGAATATCCAAGTTCTCGAGATACACGAGATTATGCACCACCACCAAGAGATTATACTTACCGTGATTATGGTCATTCCAGTTCACGAG

ATGACTATCCATCAAGAGGCTATAG TGATAGAGATGGCTATGGTCGGGATCGGGACTATTCAGATCATCCAAGTGGAGGTTCCTACAGAGATTCGTATG

AGAGTTATG GTAACTCACGTAGTGCTCCACCTACACGAGGGCCCCCGCCATCTTATGGTGGAAGCAGTCGCTATGATGATTACAGCAGCTCACGTGACG

GATATGGTGGAAGTCGAGACAGTTACTCAAGCAGCCGAAGTGATCTCTACTCAAGTGGTCGTGATCGCGTGGGCAGACAAGAAAGAGGGCTTCCCCCTTC

TATGGAAAGGGGGTACCCTCCTCCACGTGATTCCTACAGCAGTTCAAGCCGCGGAGCACCAAGAGGTGGTGGCCGTGGAGGAAGCCGATCTGATAGAGGG

GGAGGCAGAAGCAGATACTAGGAACAAACAAAACTTTTGGACCAAAAAAATCCCCATTCAAAGCAACAAACAAAAGTGGAAACTTTCTGTCATAAACTAC

CCAAGGACTACTAAAAGGAAAAATTGTGTTACCTTTTTAAAATTTCCTGTTCCCTTTTAATAATTTTTATGTTCTTGTGAGGGAAAAAGTAAGACGTGTT

TAATTTTATTTGCTAGTATGAGCTGCTTTCAACAAGCAAATGGTAGATGTGTGAGCCTTGACTTGTTCCTAGTGTTGTAATTTTCCAAGTGAAAGTGTCC

CTGAAGGCCAGCCACTTCCTGATTTTTTTCCCCAGTAAATGAGGCAAGCAACCCCAAGATCATCCACAAACTTCCAGCCATCTAGATGGCCTCTGGTCTC

CACTGAGAGCTGAATCGCCCTGCCTGTGCAGACAAGCTAGCCATTAGAGAGGGTTGGTTGGGTGTGCTACTTTCAGTATTTCAGGGTGTCTTCCAACTGA

AATCTCAATCTTCGCAGTATATATATTAAAACCAACGAGCAAACCTGAGCTCCGATGCCTAGGATGTACTGTTTACCCAGAAACCCCCCAAAAAAGCAGA

TGGATACTGGCCATATTTTGCTTTTTTGACACTTCCTTGGGAATCTACAAGAACCTCCCTTCCCCCTCCCCGAGTAAGACCTAAGACCATTTAAGTGTGT

GTTAAACAACTACAAAATACTCAATAAAACGTTTGGCCAAAG
Translation
 - UNI29561 - MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV - UNI29561 - VLLMKDRETNKSRGFAFVTFESPADAKDAARDMNG

K SLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMD DDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPS

GPVRSSSGLGGRA APVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDS SYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYS SD

RDGYGRDRDYSDHPSGGSYRDSYESYG GNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP

RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Transcript ENSMUST00000114730
Sequence
AGCGTCATTTCTGTTCCGTTCTGAAAATCGGTAGCTGTCACTGGTGCGGCGCTGCTCGGGAGGTCCGGTCGGCGAGCTCAGAGGAGCTTGAGACCGTCGC

AGTCCCCTCGG - UNI29561 - AGGAAAAATGGTTGAAGCAGATCGCCCAGGAAAGCTCTTTATTGGTGGGCTTAATACAGAGACGAATGAGAAAGC

CCTTGAGGCAGTGTTTGGCAAATATGGACGAATAGTGGAAG - UNI29561 - TTCTTTTGATGAAGGACCGAGAAACGAATAAGTCAAGAGGATTCG

CTTTTGTCACTTTTGAAAGCCCAGCAGATGCAAAGGATGCTGCCAGAGACATGAATGGAAAG TCCTTAGATGGGAAAGCCATCAAGGTGGAGCAAGCCA

CCAAACCATCATTTGAAAGTGGTAGACGTGGACTACCCCCACCTCCAAGAAGCAGAGGCCCTCCCAGAGGTCTTCGAGGAGGAAGAGGAGGAAGTGGAGG

AACCAGAGGACCCCCCTCCCGGGGAGGACACATGG ATGATGGTGGCTACTCCATGAATTTTACCATGAGTTCTTCCAGAGGACCTCTGCCAGTAAAACG

AGGACCACCACCACGAAGTGGAGGTCCTCCTCCTAAAAGATCAGCACCTTCTGGACCAGTTCGTAGCAGCAGTGGACTGGGAGGAAGAG CCCCTGTGTC

CCGTGGAAGAGATGGTTACGGAGGCCCGCCACGAAGGGAGCCCCTGCCTTCTCGAAGAGATGTTTATTTGTCCCCGAGAGATGATGGATATTCCACTAAA

GACAG CTATTCAAGCAGAGAATATCCAAGTTCTCGAGATACACGAGATTATGCACCACCACCAAGAGATTATACTTACCGTGATTATGGTCATTCCAGT

TCACGAGATGACTATCCATCAAGAGGCTATAG TGATAGAGATGGCTATGGTCGGGATCGGGACTATTCAGATCATCCAAGTGGAGGTTCCTACAGAGAT

TCGTATGAGAGTTATG GTAACTCACGTAGTGCTCCACCTACACGAGGGCCCCCGCCATCTTATGGTGGAAGCAGTCGCTATGATGATTACAGCAGCTCA

CGTGACGGATATGGTGGAAGTCGAGACAGTTACTCAAGCAGCCGAAGTGATCTCTACTCAAGTGGTCGTGATCGCGTGGGCAGACAAGAAAGAGGGCTTC

CCCCTTCTATGGAAAGGGGGTACCCTCCTCCACGTGATTCCTACAGCAGTTCAAGCCGCGGAGCACCAAGAGGTGGTGGCCGTGGAGGAAGCCGATCTGA

TAGAGGGGGAGGCAGAAGCAGATACTAGGAACAAACAAAACTTTTGGACCAAAAAAATCCCCATTCAAAGCAACAAACAAAAGTGGAAACTTTCTGTCAT

AAACTACCCAAGGACTACTAAAAGGAAAAATTGTGTTACCTTTTTAAAATTTCCTGTTCCCTTTTAATAATTTTTATGTTCTTGTGAGGGAAAAAGTAAG

ACGTGTTTAATTTTATTTGCTAGTATGAGCTGCTTTCAACAAGCAAATGGTAGATGTGTGAGCCTTGACTTGTTCCTAGTGTTGTAATTTTCCAAGTGAA

AGTGTCCCTGAAGGCCAGCCACTTCCTGATTTTTTTCCCCAGTAAATGAGGCAAGCAACCCCAAGATCATCCACAAACTTCCAGCCATCTAGATGGCCTC

TGGTCTCCACTGAGAGCTGAATCGCCCTGCCTGTGCAGACAAGCTAGCCATTAGAGAGGGTTGGTTGGGTGTGCTACTTTCAGTATTTCAGGGTGTCTTC

CAACTGAAATCTCAATCTTCGCAGTATATATATTAAAACCAACGAGCAAACCTGAGCTCCGATGCCTAGGATGTACTGTTTACCCAGAAACCCCCCAAAA

AAGCAGATGGATACTGGCCATATTTTGCTTTTTTGACACTTCCTTGGGAATCTACAAGAACCTCCCTTCCCCCTCCCCGAGTAAGACCTAAGACCATTTA

AGTGTGTGTTAAACAACTACAAAATACTCAATAAAACGTTTGGCCAAAGTCAA
Translation
 - UNI29561 - MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV - UNI29561 - VLLMKDRETNKSRGFAFVTFESPADAKDAARDMNG

K SLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMD DDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPS

GPVRSSSGLGGRA APVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDS SYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYS SD

RDGYGRDRDYSDHPSGGSYRDSYESYG GNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP

RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Transcript ENSMUST00000033470
Sequence
CTCGTTGCGCAGTCGTCCTAGCGTCATTTCTGTTCCGTTCTGAAAATCGGTAGCTGTCACTGGTGCGGCGCTGCTCGGGAGGTCCGGTCGGCGAGCTCAG

AGGAGCTTGAGACCGTCGCAGTCCCCTCGG - UNI29561 - ACCCCCATCGGTTAAGAGGAAAAATGGTTGAAGCAGATCGCCCAGGAAAGCTCTTT

ATTGGTGGGCTTAATACAGAGACGAATGAGAAAGCCCTTGAGGCAGTGTTTGGCAAATATGGACGAATAGTGGAAG - UNI29561 - TTCTTTTGAT

GAAGGACCGAGAAACGAATAAGTCAAGAGGATTCGCTTTTGTCACTTTTGAAAGCCCAGCAGATGCAAAGGATGCTGCCAGAGACATGAATGGAAAG TC

CTTAGATGGGAAAGCCATCAAGGTGGAGCAAGCCACCAAACCATCATTTGAAAGTGGTAGACGTGGACTACCCCCACCTCCAAGAAGCAGAGGCCCTCCC

AGAGGTCTTCGAGGAGGAAGAGGAGGAAGTGGAGGAACCAGAGGACCCCCCTCCCGGGGAGGACACATGG ATGATGGTGGCTACTCCATGAATTTTACC

ATGAGTTCTTCCAGAGGACCTCTGCCAGTAAAACGAGGACCACCACCACGAAGTGGAGGTCCTCCTCCTAAAAGATCAGCACCTTCTGGACCAGTTCGTA

GCAGCAGTGGACTGGGAGGAAGAG CCCCTGTGTCCCGTGGAAGAGATGGTTACGGAGGCCCGCCACGAAGGGAGCCCCTGCCTTCTCGAAGAGATGTTT

ATTTGTCCCCGAGAGATGATGGATATTCCACTAAAGACAG CTATTCAAGCAGAGAATATCCAAGTTCTCGAGATACACGAGATTATGCACCACCACCAA

GAGATTATACTTACCGTGATTATGGTCATTCCAGTTCACGAGATGACTATCCATCAAGAGGCTATAG TGATAGAGATGGCTATGGTCGGGATCGGGACT

ATTCAGATCATCCAAGTGGAGGTTCCTACAGAGATTCGTATGAGAGTTATG GTAACTCACGTAGTGCTCCACCTACACGAGGGCCCCCGCCATCTTATG

GTGGAAGCAGTCGCTATGATGATTACAGCAGCTCACGTGACGGATATGGTGGAAGTCGAGACAGTTACTCAAGCAGCCGAAGTGATCTCTACTCAAGTGG

TCGTGATCGCGTGGGCAGACAAGAAAGAGGGCTTCCCCCTTCTATGGAAAGGGGGTACCCTCCTCCACGTGATTCCTACAGCAGTTCAAGCCGCGGAGCA

CCAAGAGGTGGTGGCCGTGGAGGAAGCCGATCTGATAGAGGGGGAGGCAGAAGCAGATACTAGGAACAAACAAAACTTTTGGACCAAAAAAATCCCCATT

CAAAGCAACAAACAAAAGTGGAAACTTTCTGTCATAAACTACCCAAGGACTACTAAAAGGAAAAATTGTGTTACCTTTTTAAAATTTCCTGTTCCCTTTT

AATAATTTTTATGTTCTTGTGAGGGAAAAAGTAAGACGTGTTTAATTTTATTTGCTAGTATGAGCTGCTTTCAACAAGCAAATGGTAGATGTGTGAGCCT

TGACTTGTTCCTAGTGTTGTAATTTTCCAAGTGAAAGTGTCCCTGAAGGCCAGCCACTTCCTGATTTTTTTCCCCAGTAAATGAGGCAAGCAACCCCAAG

ATCATCCACAAACTTCCAGCCATCTAGATGGCCTCTGGTCTCCACTGAGAGCTGAATCGCCCTGCCTGTGCAGACAAGCTAGCCATTAGAGAGGGTTGGT

TGGGTGTGCTACTTTCAGTATTTCAGGGTGTCTTCCAACTGAAATCTCAATCTTCGCAGTATATATATTAAAACCAACGAGCAAACCTGAGCTCCGATGC

CTAGGATGTACTGTTTACCCAGAAACCCCCCAAAAAAGCAGATGGATACTGGCCATATTTTGCTTTTTTGACACTTCCTTGGGAATCTACAAGAACCTCC

CTTCCCCCTCCCCGAGTAAGACCTAAGACCATTTAAGTGTGTGTTAAACAACTACAAAATACTCAATAAAACGTTTGGCCAAAGTCAACCCTGAAGCTGC

Translation
 - UNI29561 - MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEV - UNI29561 - VLLMKDRETNKSRGFAFVTFESPADAKDAARDMNG

K SLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMD DDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPS

GPVRSSSGLGGRA APVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDS SYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYS SD

RDGYGRDRDYSDHPSGGSYRDSYESYG GNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP

RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

For any suggestions or comments, please send an email to unitrap@crg.es