Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031139 (Mcf2)
Chromosomal location
Chr X: 57309135 - 57432083 (-)
Description
mcf.2 transforming sequence Gene [Source:MGI (curated);Acc:Mcf2-001]
RefSeq_dna
NM_133197 
RefSeq_peptide
NP_573460.2 
UniGene
Mm.93796 
MGI
MGI:96932 
Uniprot/SPTREMBL
Q8C067 Q99N72 A2AET8 Q7TNJ5 A2AEU1 Q8BLE2 
Human Ortholog
ENSG00000101977 (MCF2)
Omim not available
UniTrap UNI26976
Vector Insertion
Chr X: 57413473 - 57431758
Public Clones D100F12 (ggtc) CMHD-GT_461H9-3 (cmhd) IST13052B6 (tigm) IST12579C2BBF1 (tigm)
IST10856G3 (tigm) IST14796G8 (tigm) IST11375B11 (tigm) IST11778F12 (tigm)
Private Clones OST80979 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24869
Vector Insertion
Chr X: 57406168 - 57408779
Public Clones not available
Private Clones OST202783 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101531
Sequence
CCAGCTCTGCCGCGGTGGTAATGGAAGCAGCCGCCGTAGCTTTGTTTGATAGAGATTTTTGGCTGCTGGTTTTAAATACCACCCAAGAAGCAGCTCGTAT

TTCATCAATGTTGTGTTGACAATCGGAAGAGAAGAGTGTGGTTGTGTATAGGCGAGATGGCAGAAGCAAATCCCCCGAGAGGCAAGATGAGGTTCAGAAG

GAATGCG GCCTCCTTCCCTGGGAGCTTACACTTAGTCCTGGTTTTGCGTCCTACCAGTTTTCTTCAACGGACTTTCACGGACATTGGATTTCGATTTAG

CCAGGAGGATTTTATGCTGAAATTACCA GTTGTTATGCTGAGCTCAGTTAGTGATTTGCTGACATACATTGATGACAAGCAGTTAACCCCTGAGTTAGG

CGGCACCTTGCAGTACTGCCACAGTGAATGGATCATCTTCAGAAAT GCCATAGAGAAGTTTGCTGTCACAGTGAAAGAAATGGCTCAGATGTTGCAATC

CTTTGGAACAGAATTGGCTGAAACAGAGCTACCACAGGATATCCTTTCAATAGAAGAGATTCTGGCAGGTCGAGCCGAAAGGTATCACCTGTTGAAG AA

TGACTTAACTGCTGTAACCAAAGAAGGAAAAGTTCTGCTCATGAACCTGCAAGTGCCTGCCACTGAAGAAACTGTCAGTTCAAGCCTTGAATGTACTCAG

CACATAAATGGCGACTGGCAAACTATTAAAAA GTTGCTGGCTCAGGTGCATGATATGGAAACTGCTTTTGATGGATTTTGGGAAAAACATCAGCTGAAA

ATGGAGCAGTATCTGCAACTGTGGAAGTTTGAACAAGACTTTCAAGAG GCTGTGACTCAAGTTGAATTTTTATTAAGTCAACAAAGAGAACTGGGTGAT

ATAACAGGGAACTTAGCTCAAGTAAAACAAAGACTTAAAAAACTAGAGATCTTAGATGATAAATCTCAG GAACTGTTAACCAAGGCCCGGATTGTGATA

CTACGTGGCCACAAGCTGGCATCGAATCACCACTATGCACTTGATTTAATTTGCCAGCGATGCAATGAACTACGCTACCTTTCTGATATTTTAGTTAATG

AGATCAGAACAAAGCGGGTCCAACTGAGCAGGACTTTCAAAGTGCATAGACTCTTACAGCAG GCACGTCAGTGCTGTGATCAAGGGGAATGCCTCCTGG

CTAGCCAAGGAATGGATAAGTTTCAGACTAAAGAAGATGCTCAGAAAGCCCTTCAGGATGTGGACAATTTCCTTCAAATGGCCATGCCTTTCATCAATTA

TGATATCGAAAGCCTGCAATATGAATTTGATGTACTCCTATCTCCTGAACTCAAG GCTCAAATGCAGAATATACAACTAAAGCTTGAAAATATTCGAAG

TGCATTTCAGAACCAACAGGCTGGTTGTAAGAGCCTAAAAGAAGTACCCGAGGGGGCGTTCCAGAACTTGGTTCCTGCATCTGAAAATGTGATGCGGTCC

AGAATGATATTCTTTTCACCGAAACATG TGAAAAAGTCTTGGAGACAGATTCACGCTCAGAGCAATGTGAAA GTTGAAGCCGTTGAGGATAGCCAAGA

GAAGAATTCTGATCAGTCTCCCAAATTGGACAATAGCTTGGATATTTTAAAGAA CCATGTCCTAAATGAGCTGATACAGACAGAGAGAGCATATGTTCG

AGAGCTGTTTACTGTTTTGTTG GGCTACAGATCTGAGATGGACAATCCACAGATGTTTGATCTTATGCCACCTCTCCTGAGAAATAAAAAGGATGTTCT

CTTTGGAAATATGGCAGAAATATACGAATTCCATAACAA CATTTTCATGAGCAGACTGGAAGATTGCTCTGATGCTCCAGAAAGAGTGGGACCTTGCTT

CCTGGAAAGG AAGGATGATTTTCAGATGTATGCCAAATATTGTCAGAATAAACCCAGGTCAGAGTTAATTTGGAGGAAGTATTCTGAATGTGCCTTTTT

CCAG GAATGTCAACGAAAATTGAAACATCGACTTGGTCTGGATTCCTATTTGCTCAAACCTGTTCAACGAATCACTAAGTATCAGTTGCTTTTAAAG G

AGCTTTTAAAGTATAGCAAAGAAGGTGAAGGAACTACTAAATTAAAGGAGGCACTTGACTCAATGCTGGAGCTGCTGAAGTCAGTGAATGACTCCATGCA

TCAGACTGCCATCAATGGCTATGTT GGAAATATAAATGAGCTGGGCAAGATGGTTCTTCAAGGTTCCTTCAATGTTTGGCTAGGACACCGGAAAGGTGC

TACAAAAATGAAGGATTTTGCACGTTTCAAACCCATGCAGAGACATCTTTTCTTATATGAAAAAGCTGTTATGTTTTGTAAGAGGCGTTTCGAATCTGGA

GAAGGTGCTGATAGATACCCATCATACAGTTTTAAGCACTGCCTAAAA ATGGAAGATGTTGGCATCACAGAACATGTGAAAGGTGATAACCGCAAATTT

GAAATACGGTATAGTGAGAAGGAAGAAATTTACATTGTTCAG GCTCCAAATGTTGATGTGAAGATGTTATGGCTAAAAGAAATAAGAAAAATTTTGGTG

CAGCAGAAGGAACTTATGACTG CTAAAACCCAGCAGGATCAGGCACTAGACCAGGACCAACTTTTCCCCCAGCAGCAGAATGCCGA GCTATGCAAAAG

CTCACCTTTTTGTGTGTGTGAGGAAACTCTTTTCAACGCCACAGAAGCAGGAGCAGAAGTGGAGCAAGCTGGTGCCCTGATAAAGGTCAGGGAGGCAGCT

GTGCTAGCTCAAGCAGAGGCAAGTTCAGCAG CTTGGAATGGGATGTTACCATCTGCAGAAGGCGCTGCTGCAATTGCTGAACATTCATACAATTATTTC

TCCTCTAACAATGACCATGGAGAAGATAGGACACAAATG AGACACATGTCGGAGGTGACATTCTAGTTGTAAAGAAGCCACAGTGTCATCTGGCAAGTT

GCTCTGCCTGCCTGCTTCTCAGCCCATGTGGAAAAAAAAAAACACCCCTCAAAGGAATTTCAGCCCAAATGATGGGATTTCCGCGCCCCCCCCCCAGGTT

AATATATTTAAACATGCACAAAACCAACGGCATATACTTCTTTCTTTCACTTTTTATTCCTTAAATTGCATACGTGTGTAAGTCATTGTGCCGGATAAAA

TCAATCTCATCTCAGAATATTTTTGACTTGAAAATTGTTTCTTCTCTGTCTACTTTGCAACCAAATGCAATCAGTGTGCCTTGAATTATTTAGCTTATTA

TTAATTAAGTTAAACTAGGGCTGTAGAATAGTTAAGGCCAAGTGAAGCACAACGCTATGATTTAAAGCGCTTTTTAGACCCAGCGCTCCTTTAACCCATG

CAAGACAATGGTGGAGTTCAGAAGTCCTGGGGGTGGGGGTCCTTAGTAAATTCTATTCAGGGCTATTGCCTTTTCTATGTGCCAAGATGAACTTTTCCTG

AGAGTAGTTTACAAATTGCATTTAAAATGTAATATTTTCATGCTTGTTTCTTTTTCTGGATTTATGCTTATAATTCATGTAGCAAATTAGTTGTGCTCTA

TTATCTTCTGTACATTTCATGCTGTAATCATTTTTTTTCCAAATAAAAATGAAAACTTCAGGTTCCACAAATT
Translation
MAEANPPRGKMRFRRNA ASFPGSLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLP VVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRN A

IEKFAVTVKEMAQMLQSFGTELAETELPQDILSIEEILAGRAERYHLLK NDLTAVTKEGKVLLMNLQVPATEETVSSSLECTQHINGDWQTIKK KLLA

QVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQE AVTQVEFLLSQQRELGDITGNLAQVKQRLKKLEILDDKSQ ELLTKARIVILRGHKLASNHHYA

LDLICQRCNELRYLSDILVNEIRTKRVQLSRTFKVHRLLQQ ARQCCDQGECLLASQGMDKFQTKEDAQKALQDVDNFLQMAMPFINYDIESLQYEFDVL

LSPELK AQMQNIQLKLENIRSAFQNQQAGCKSLKEVPEGAFQNLVPASENVMRSRMIFFSPKHV VKKSWRQIHAQSNVK VEAVEDSQEKNSDQSPKL

DNSLDILKN NHVLNELIQTERAYVRELFTVLL GYRSEMDNPQMFDLMPPLLRNKKDVLFGNMAEIYEFHNN NIFMSRLEDCSDAPERVGPCFLER K

DDFQMYAKYCQNKPRSELIWRKYSECAFFQ ECQRKLKHRLGLDSYLLKPVQRITKYQLLLK ELLKYSKEGEGTTKLKEALDSMLELLKSVNDSMHQTA

INGYV GNINELGKMVLQGSFNVWLGHRKGATKMKDFARFKPMQRHLFLYEKAVMFCKRRFESGEGADRYPSYSFKHCLK MEDVGITEHVKGDNRKFEI

RYSEKEEIYIVQ APNVDVKMLWLKEIRKILVQQKELMTA AKTQQDQALDQDQLFPQQQNAE ELCKSSPFCVCEETLFNATEAGAEVEQAGALIKVRE

AAVLAQAEASSAA AWNGMLPSAEGAAAIAEHSYNYFSSNNDHGEDRTQM RHMSEVTF
Transcript ENSMUST00000033478
Sequence
CCAGCTCTGCCGCGGTGGTAATGGAAGCAGCCGCCGTAGCTTTGTTTGATAGAGATTTTTGGCTGCTGGTTTTAAATACCACCCAAGAAGCAGCTCGTAT

TTCATCAATGTTGTGTTGACAATCGGAAGAGAAGAGTGTGGTTGTGTATAGGCGAGATGGCAGAAGCAAATCCCCCGAGAGGCAAGATGAGGTTCAGAAG

GAATGCG GCCTCCTTCCCTGGGAGCTTACACTTAGTCCTGGTTTTGCGTCCTACCAGTTTTCTTCAACGGACTTTCACGGACATTGGATTTCGATTTAG

CCAGGAGGATTTTATGCTGAAATTACCA GTTGTTATGCTGAGCTCAGTTAGTGATTTGCTGACATACATTGATGACAAGCAGTTAACCCCTGAGTTAGG

CGGCACCTTGCAGTACTGCCACAGTGAATGGATCATCTTCAGAAAT GCCATAGAGAAGTTTGCTGTCACAGTGAAAGAAATGGCTCAGATGTTGCAATC

CTTTGGAACAGAATTGGCTGAAACAGAGCTACCACAGGATATCCTTTCAATAGAAGAGATTCTGGCAGGTCGAGCCGAAAGGTATCACCTGTTGAAG AA

TGACTTAACTGCTGTAACCAAAGAAGGAAAAGTTCTGCTCATGAACCTGCAAGTGCCTGCCACTGAAGAAACTGTCAGTTCAAGCCTTGAATGTACTCAG

CACATAAATGGCGACTGGCAAACTATTAAAAA GTTGCTGGCTCAGGTGCATGATATGGAAACTGCTTTTGATGGATTTTGGGAAAAACATCAGCTGAAA

ATGGAGCAGTATCTGCAACTGTGGAAGTTTGAACAAGACTTTCAAGAG GCTGTGACTCAAGTTGAATTTTTATTAAGTCAACAAAGAGAACTGGGTGAT

ATAACAGGGAACTTAGCTCAAGTAAAACAAAGACTTAAAAAACTAGAGATCTTAGATGATAAATCTCAG GAACTGTTAACCAAGGCCCGGATTGTGATA

CTACGTGGCCACAAGCTGGCATCGAATCACCACTATGCACTTGATTTAATTTGCCAGCGATGCAATGAACTACGCTACCTTTCTGATATTTTAGTTAATG

AGATCAGAACAAAGCGGGTCCAACTGAGCAGGACTTTCAAAGTGCATAGACTCTTACAGCAG GCACGTCAGTGCTGTGATCAAGGGGAATGCCTCCTGG

CTAGCCAAGGAATGGATAAGTTTCAGACTAAAGAAGATGCTCAGAAAGCCCTTCAGGATGTGGACAATTTCCTTCAAATGGCCATGCCTTTCATCAATTA

TGATATCGAAAGCCTGCAATATGAATTTGATGTACTCCTATCTCCTGAACTCAAG GCTCAAATGCAGAATATACAACTAAAGCTTGAAAATATTCGAAG

TGCATTTCAGAACCAACAGGCTGGTTGTAAGAGCCTAAAAGAAGTACCCGAGGGGGCGTTCCAGAACTTGGTTCCTGCATCTGAAAATGTGATGCGGTCC

AGAATGATATTCTTTTCACCGAAACATG TGGGAATTGGATATTCTTTCTTTCAAGCATGTAGAATTTTTTTAAAAG TGAAAAAGTCTTGGAGACAGAT

TCACGCTCAGAGCAATGTGAAA GTTGAAGCCGTTGAGGATAGCCAAGAGAAGAATTCTGATCAGTCTCCCAAATTGGACAATAGCTTGGATATTTTAAA

GAA CCATGTCCTAAATGAGCTGATACAGACAGAGAGAGCATATGTTCGAGAGCTGTTTACTGTTTTGTTG GGCTACAGATCTGAGATGGACAATCCAC

AGATGTTTGATCTTATGCCACCTCTCCTGAGAAATAAAAAGGATGTTCTCTTTGGAAATATGGCAGAAATATACGAATTCCATAACAA CATTTTCATGA

GCAGACTGGAAGATTGCTCTGATGCTCCAGAAAGAGTGGGACCTTGCTTCCTGGAAAGG AAGGATGATTTTCAGATGTATGCCAAATATTGTCAGAATA

AACCCAGGTCAGAGTTAATTTGGAGGAAGTATTCTGAATGTGCCTTTTTCCAG GAATGTCAACGAAAATTGAAACATCGACTTGGTCTGGATTCCTATT

TGCTCAAACCTGTTCAACGAATCACTAAGTATCAGTTGCTTTTAAAG GAGCTTTTAAAGTATAGCAAAGAAGGTGAAGGAACTACTAAATTAAAGGAGG

CACTTGACTCAATGCTGGAGCTGCTGAAGTCAGTGAATGACTCCATGCATCAGACTGCCATCAATGGCTATGTT GGAAATATAAATGAGCTGGGCAAGA

TGGTTCTTCAAGGTTCCTTCAATGTTTGGCTAGGACACCGGAAAGGTGCTACAAAAATGAAGGATTTTGCACGTTTCAAACCCATGCAGAGACATCTTTT

CTTATATGAAAAAGCTGTTATGTTTTGTAAGAGGCGTTTCGAATCTGGAGAAGGTGCTGATAGATACCCATCATACAGTTTTAAGCACTGCCTAAAA AT

GGAAGATGTTGGCATCACAGAACATGTGAAAGGTGATAACCGCAAATTTGAAATACGGTATAGTGAGAAGGAAGAAATTTACATTGTTCAG GCTCCAAA

TGTTGATGTGAAGATGTTATGGCTAAAAGAAATAAGAAAAATTTTGGTGCAGCAGAAGGAACTTATGACTG CTAAAACCCAGCAGGATCAGGCACTAGA

CCAGGACCAACTTTTCCCCCAGCAGCAGAATGCCGA GCTATGCAAAAGCTCACCTTTTTGTGTGTGTGAGGAAACTCTTTTCAACGCCACAGAAGCAGG

AGCAGAAGTGGAGCAAGCTGGTGCCCTGATAAAGGTCAGGGAGGCAGCTGTGCTAGCTCAAGCAGAGGCAAGTTCAGCAG CTTGGAATGGGATGTTACC

ATCTGCAGAAGGCGCTGCTGCAATTGCTGAACATTCATACAATTATTTCTCCTCTAACAATGACCATGGAGAAGATAGGACACAAATG AGACACATGTC

GGAGGTGACATTCTAGTTGTAAAGAAGCCACAGTGTCATCTGGCAAGTTGCTCTGCCTGCCTGCTTCTCAGCCCATGTGGAAAAAAAAAAACACCCCTCA

AAGGAATTTCAGCCCAAATGATGGGATTTCCGCGCCCCCCCCCCAGGTTAATATATTTAAACATGCACAAAACCAACGGCATATACTTCTTTCTTTCACT

TTTTATTCCTTAAATTGCATACGTGTGTAAGTCATTGTGCCGGATAAAATCAATCTCATCTCAGAATATTTTTGACTTGAAAATTGTTTCTTCTCTGTCT

ACTTTGCAACCAAATGCAATCAGTGTGCCTTGAATTATTTAGCTTATTATTAATTAAGTTAAACTAGGGCTGTAGAATAGTTAAGGCCAAGTGAAGCACA

ACGCTATGATTTAAAGCGCTTTTTAGACCCAGCGCTCCTTTAACCCATGCAAGACAATGGTGGAGTTCAGAAGTCCTGGGGGTGGGGGTCCTTAGTAAAT

TCTATTCAGGGCTATTGCCTTTTCTATGTGCCAAGATGAACTTTTCCTGAGAGTAGTTTACAAATTGCATTTAAAATGTAATATTTTCATGCTTGTTTCT

TTTTCTGGATTTATGCTTATAATTCATGTAGCAAATTAGTTGTGCTCTATTATCTTCTGTACATTTCATGCTGTAATCATTTTTTTTCCAAATAAAAATG

AAAACTTCAGGTTCCACAAATT
Translation
MAEANPPRGKMRFRRNA ASFPGSLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLP VVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRN A

IEKFAVTVKEMAQMLQSFGTELAETELPQDILSIEEILAGRAERYHLLK NDLTAVTKEGKVLLMNLQVPATEETVSSSLECTQHINGDWQTIKK KLLA

QVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQE AVTQVEFLLSQQRELGDITGNLAQVKQRLKKLEILDDKSQ ELLTKARIVILRGHKLASNHHYA

LDLICQRCNELRYLSDILVNEIRTKRVQLSRTFKVHRLLQQ ARQCCDQGECLLASQGMDKFQTKEDAQKALQDVDNFLQMAMPFINYDIESLQYEFDVL

LSPELK AQMQNIQLKLENIRSAFQNQQAGCKSLKEVPEGAFQNLVPASENVMRSRMIFFSPKHV VGIGYSFFQACRIFLKV VKKSWRQIHAQSNVK 

VEAVEDSQEKNSDQSPKLDNSLDILKN NHVLNELIQTERAYVRELFTVLL GYRSEMDNPQMFDLMPPLLRNKKDVLFGNMAEIYEFHNN NIFMSRLE

DCSDAPERVGPCFLER KDDFQMYAKYCQNKPRSELIWRKYSECAFFQ ECQRKLKHRLGLDSYLLKPVQRITKYQLLLK ELLKYSKEGEGTTKLKEAL

DSMLELLKSVNDSMHQTAINGYV GNINELGKMVLQGSFNVWLGHRKGATKMKDFARFKPMQRHLFLYEKAVMFCKRRFESGEGADRYPSYSFKHCLK M

EDVGITEHVKGDNRKFEIRYSEKEEIYIVQ APNVDVKMLWLKEIRKILVQQKELMTA AKTQQDQALDQDQLFPQQQNAE ELCKSSPFCVCEETLFNA

TEAGAEVEQAGALIKVREAAVLAQAEASSAA AWNGMLPSAEGAAAIAEHSYNYFSSNNDHGEDRTQM RHMSEVTF
Transcript ENSMUST00000063507
Sequence
ATGGCGGAAGCAGGGCCCCCTCCAGCAAGGTTCCCTCCAGCAAGGCTCCCTCCAGCAGGGTCCTCTCGGGCTGGGCTCCCTCCAACAGGGTCCCCTCCCG

CTTCCACTCCGGCCCTGGCCTCGCAGTGGCTGGCGGTCAAGCGTTTGCCTAGGGCTGCCGCCAAGGCGCCCAATCTCCAGCTGAATCAGGACCACTGTTC

TTTCGTGCCGTTCACGCAGGCGGTCCCGGTGCAGGTGGACATGGCCATGGCCCTGCATCGCGTTAGGATCGCGGAGAAGTACGGGAAGAACTACCTCTGC

TTGCTGCAGGCAGTCTTCCTAGCAG - UNI26976 - AAACTGGGCTGCTCCTCCAGTTAAAGGACATCAATCATTTCCTAATGCAAGACATTGCTTT

CCTGTCTG GTGGCCGGGGAAAGGACAATGCTTGGATCATTACATTTCCAGAAAACTGTAACTTCAGATGCATACCAGAGGAAGTAATTGCAAAAGTGCT

CAATTACTTGACATCTATTGCAAG - UNI24869 - GCAAAGTGGATCTGACTCCCGATTTACTATTATTCTAGATCGAAGACTGGATACATGGGCTT

CCCTCAAAATTTCCCTCCAGAAAATCTCA GCCTCCTTCCCTGGGAGCTTACACTTAGTCCTGGTTTTGCGTCCTACCAGTTTTCTTCAACGGACTTTCA

CGGACATTGGATTTCGATTTAGCCAGGAGGATTTTATGCTGAAATTACCA GTTGTTATGCTGAGCTCAGTTAGTGATTTGCTGACATACATTGATGACA

AGCAGTTAACCCCTGAGTTAGGCGGCACCTTGCAGTACTGCCACAGTGAATGGATCATCTTCAGAAAT GCCATAGAGAAGTTTGCTGTCACAGTGAAAG

AAATGGCTCAGATGTTGCAATCCTTTGGAACAGAATTGGCTGAAACAGAGCTACCACAGGATATCCTTTCAATAGAAGAGATTCTGGCAGGTCGAGCCGA

AAGGTATCACCTGTTGAAG AATGACTTAACTGCTGTAACCAAAGAAGGAAAAGTTCTGCTCATGAACCTGCAAGTGCCTGCCACTGAAGAAACTGTCAG

TTCAAGCCTTGAATGTACTCAGCACATAAATGGCGACTGGCAAACTATTAAAAA GTTGCTGGCTCAGGTGCATGATATGGAAACTGCTTTTGATGGATT

TTGGGAAAAACATCAGCTGAAAATGGAGCAGTATCTGCAACTGTGGAAGTTTGAACAAGACTTTCAAGAG GCTGTGACTCAAGTTGAATTTTTATTAAG

TCAACAAAGAGAACTGGGTGATATAACAGGGAACTTAGCTCAAGTAAAACAAAGACTTAAAAAACTAGAGATCTTAGATGATAAATCTCAG GAACTGTT

AACCAAGGCCCGGATTGTGATACTACGTGGCCACAAGCTGGCATCGAATCACCACTATGCACTTGATTTAATTTGCCAGCGATGCAATGAACTACGCTAC

CTTTCTGATATTTTAGTTAATGAGATCAGAACAAAGCGGGTCCAACTGAGCAGGACTTTCAAAGTGCATAGACTCTTACAGCAG GCACGTCAGTGCTGT

GATCAAGGGGAATGCCTCCTGGCTAGCCAAGGAATGGATAAGTTTCAGACTAAAGAAGATGCTCAGAAAGCCCTTCAGGATGTGGACAATTTCCTTCAAA

TGGCCATGCCTTTCATCAATTATGATATCGAAAGCCTGCAATATGAATTTGATGTACTCCTATCTCCTGAACTCAAG GCTCAAATGCAGAATATACAAC

TAAAGCTTGAAAATATTCGAAGTGCATTTCAGAACCAACAGGCTGGTTGTAAGAGCCTAAAAGAAGTACCCGAGGGGGCGTTCCAGAACTTGGTTCCTGC

ATCTGAAAATGTGATGCGGTCCAGAATGATATTCTTTTCACCGAAACATG TGAAAAAGTCTTGGAGACAGATTCACGCTCAGAGCAATGTGAAA GTTG

AAGCCGTTGAGGATAGCCAAGAGAAGAATTCTGATCAGTCTCCCAAATTGGACAATAGCTTGGATATTTTAAAGAA CCATGTCCTAAATGAGCTGATAC

AGACAGAGAGAGCATATGTTCGAGAGCTGTTTACTGTTTTGTTG GGCTACAGATCTGAGATGGACAATCCACAGATGTTTGATCTTATGCCACCTCTCC

TGAGAAATAAAAAGGATGTTCTCTTTGGAAATATGGCAGAAATATACGAATTCCATAACAA CATTTTCATGAGCAGACTGGAAGATTGCTCTGATGCTC

CAGAAAGAGTGGGACCTTGCTTCCTGGAAAGG AAGGATGATTTTCAGATGTATGCCAAATATTGTCAGAATAAACCCAGGTCAGAGTTAATTTGGAGGA

AGTATTCTGAATGTGCCTTTTTCCAG GAATGTCAACGAAAATTGAAACATCGACTTGGTCTGGATTCCTATTTGCTCAAACCTGTTCAACGAATCACTA

AGTATCAGTTGCTTTTAAAG GAGCTTTTAAAGTATAGCAAAGAAGGTGAAGGAACTACTAAATTAAAGGAGGCACTTGACTCAATGCTGGAGCTGCTGA

AGTCAGTGAATGACTCCATGCATCAGACTGCCATCAATGGCTATGTT GGAAATATAAATGAGCTGGGCAAGATGGTTCTTCAAGGTTCCTTCAATGTTT

GGCTAGGACACCGGAAAGGTGCTACAAAAATGAAGGATTTTGCACGTTTCAAACCCATGCAGAGACATCTTTTCTTATATGAAAAAGCTGTTATGTTTTG

TAAGAGGCGTTTCGAATCTGGAGAAGGTGCTGATAGATACCCATCATACAGTTTTAAGCACTGCCTAAAA ATGGAAGATGTTGGCATCACAGAACATGT

GAAAGGTGATAACCGCAAATTTGAAATACGGTATAGTGAGAAGGAAGAAATTTACATTGTTCAG GCTCCAAATGTTGATGTGAAGATGTTATGGCTAAA

AGAAATAAGAAAAATTTTGGTGCAGCAGAAGGAACTTATGACTG CTAAAACCCAGCAGGATCAGGCACTAGACCAGGACCAACTTTTCCCCCAGCAGCA

GAATGCCGA GCTATGCAAAAGCTCACCTTTTTGTGTGTGTGAGGAAACTCTTTTCAACGCCACAGAAGCAGGAGCAGAAGTGGAGCAAGCTGGTGCCCT

GATAAAGGTCAGGGAGGCAGCTGTGCTAGCTCAAGCAGAGGCAAGTTCAGCAG CTTGGAATGGGATGTTACCATCTGCAGAAGGCGCTGCTGCAATTGC

TGAACATTCATACAATTATTTCTCCTCTAACAATGACCATGGAGAAGATAGGACACAAATG AGACACATGTCGGAGGTGACATTCTAGTTGTAAAGAAG

CCACAGTGTCATCTGGCAAGTTGCTCTGCCTGCCTGCTTCTCAGCCCATGTGGAAAAAAAAAAACACCCCTCAAAGGAATTTCAGCCCAAATGATGGGAT

TTCCGCGCCCCCCCCCCAGGTTAATATATTTAAACATGCACAAAACCAACGGCATATACTTCTTTCTTTCACTTTTTATTCCTTAAATTGCATACGTGTG

TAAGTCATTGTGCCGGATAAAATCAATCTCATCTCAGAATATTTTTGACTTGAAAATTGTTTCTTCTCTGTCTACTTTGCAACCAAATGCAATCAGTGTG

CCTTGAATTATTTAGCTTATTATTAATTAAGTTAAACTAGGGCTGTAGAATAGTTAAGGCCAAGTGAAGCACAACGCTATGATTTAAAGCGCTTTTTAGA

CCCAGCGCTCCTTTAACCCATGCAAGACAATGGTGGAGTTCAGAAGTCCTGGGGGTGGGGGTCCTTAGTAAATTCTATTCAGGGCTATTGCCTTTTCTAT

GTGCCAAGATGAACTTTTCCTGAGAGTAGTTTACAAATTGCATTTAAAATGTAATATTTTCATGCTTGTTTCTTTTTCTGGATTTATGCTTATAATTCAT

GTAGCAAATTAGTTGTGCTCTATTATCTTCTGTACATTTCATGCTGTAATCATTTTTTTTCCAAATAAAAATGAAAACTTCAGGTTCCACAAATT
Translation
MAEAGPPPARFPPARLPPAGSSRAGLPPTGSPPASTPALASQWLAVKRLPRAAAKAPNLQLNQDHCSFVPFTQAVPVQVDMAMALHRVRIAEKYGKNYLC

LLQAVFLAE - UNI26976 - ETGLLLQLKDINHFLMQDIAFLSG GGRGKDNAWIITFPENCNFRCIPEEVIAKVLNYLTSIAR - UNI24869 -

 RQSGSDSRFTIILDRRLDTWASLKISLQKIS ASFPGSLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLP VVMLSSVSDLLTYIDDKQLTPELGGT

LQYCHSEWIIFRN AIEKFAVTVKEMAQMLQSFGTELAETELPQDILSIEEILAGRAERYHLLK NDLTAVTKEGKVLLMNLQVPATEETVSSSLECTQH

INGDWQTIKK KLLAQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQE AVTQVEFLLSQQRELGDITGNLAQVKQRLKKLEILDDKSQ ELLTKARI

VILRGHKLASNHHYALDLICQRCNELRYLSDILVNEIRTKRVQLSRTFKVHRLLQQ ARQCCDQGECLLASQGMDKFQTKEDAQKALQDVDNFLQMAMPF

INYDIESLQYEFDVLLSPELK AQMQNIQLKLENIRSAFQNQQAGCKSLKEVPEGAFQNLVPASENVMRSRMIFFSPKHV VKKSWRQIHAQSNVK VEA

VEDSQEKNSDQSPKLDNSLDILKN NHVLNELIQTERAYVRELFTVLL GYRSEMDNPQMFDLMPPLLRNKKDVLFGNMAEIYEFHNN NIFMSRLEDCS

DAPERVGPCFLER KDDFQMYAKYCQNKPRSELIWRKYSECAFFQ ECQRKLKHRLGLDSYLLKPVQRITKYQLLLK ELLKYSKEGEGTTKLKEALDSM

LELLKSVNDSMHQTAINGYV GNINELGKMVLQGSFNVWLGHRKGATKMKDFARFKPMQRHLFLYEKAVMFCKRRFESGEGADRYPSYSFKHCLK MEDV

GITEHVKGDNRKFEIRYSEKEEIYIVQ APNVDVKMLWLKEIRKILVQQKELMTA AKTQQDQALDQDQLFPQQQNAE ELCKSSPFCVCEETLFNATEA

GAEVEQAGALIKVREAAVLAQAEASSAA AWNGMLPSAEGAAAIAEHSYNYFSSNNDHGEDRTQM RHMSEVTF

For any suggestions or comments, please send an email to unitrap@crg.es