Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031144 (Syp)
Chromosomal location
Chr X: 7215597 - 7230382 (+)
Description
protein tyrosine phosphatase, non-receptor type 11 Gene [Source:MGI (curated);Acc:Syp-001]
RefSeq_dna
NM_009305 
RefSeq_peptide
NP_033331.2 
UniGene
Mm.223674 
MGI
MGI:98467 
Uniprot/SWISSPROT
Q62277 
Uniprot/SPTREMBL
A4FUR8 B1AVA7 
Human Ortholog
ENSG00000102003 (SYP)
Omim not available
UniTrap UNI32187
Vector Insertion
Chr X: 7222326 - 7225682
Public Clones IST14227D4 (tigm) IST13880A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19565
Vector Insertion
Chr X: 7226014 - 7228962
Public Clones CMHD-GT_543H5-5S (cmhd)
Private Clones OST388884 (lexicon) OST377044 (lexicon) OST279906 (lexicon) OST221525 (lexicon)
OST28866 (lexicon) OST28839 (lexicon) OST21986 (lexicon) OST21430 (lexicon)
OST18539 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37211
Vector Insertion
Chr X: 7230259 - 7230378
Public Clones CMHD-GT_499B2-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033484
Sequence
ATGGACGTGGTGAATCAG CTGGTGGCTGGGGGTCAGTTCCGGGTGGTCAAGGAGCCCCTTGGCTTCGTGAAGGTGCTGCAGTGG GTCTTTGCCATCTT

CGCCTTTGCTACGTGCGGCAGCTACACCGGAGAGCTTCGGCTGAGCGTGGAGTGTGCCAACAAGACGGAGAGTGCCCTCAACATCGAAGTCGAATTTGAG

TACCCATTCAG GCTGCACCAAGTGTACTTTGATGCACCCTCCTGCGTTAAAGGGGGCACTACCAAGATCTTCCTAGTTGGTGACTACTCCTCCTCGGCT

GAATTCTTTGTCACCGTGGCTGTGTTTGCCTTCCTCTACTCCATGGGGGCCCTGGCCACCTACATCTTCCTGCAGAACAAGTACCGAGAGAACAACAAAG

GGCCAATGATG GACTTCCTGGCCACAGCAGTGTTCGCTTTCATGTGGCTAGTTAGCTCATCCGCCTGGGCCAAAGGCCTGTCCGATGTGAAGATGGCCA

CTGACCCAGAGAACATTATCAAGGAGATGCCTATGTGCCGCCAGACAGGAAACACATGCAAGGAACTGAGGGACCCTGTGACTTCAGGACTCAACACCTC

GGTG - UNI32187 - GTGTTTGGCTTCCTGAACCTGGTGCTCTGGGTTGGCAACCTATGGTTCGTGTTCAAGGAGACAGGCTGGGCCGCCCCATTCA

TGCGCGCACCTCCAGGCGCCCCAGAAAAGCAACCAGCTCCTGGCGATGCCTACGGCGATGCGGGCTATGGGCAGGGCCCCGGAGGCTATGGGCCCCAGGA

CTCCTACGGGCCTCAGGGTGGTTATCAACCCGATTACGGGCAGCCAGCCAGCGGCGGTGGCGGTGGCTACGGGCCTCAGGGCGACTATGGGCAGCAAGGC

TACGGCCAACAGGGTGCGCCCACCTCCTTCTCCAATCAGATGTAATCTG - UNI19565 - GTCAGTGAAGCCCACGAAGACCCCACGGGTGGGCAAG

AGCTCAAGAGAAGGCCTGCCCCCCTTCCCATCCCCATATCCTAGGTCTCCACCCCTCAACCCAGGAGACCCTGTCTTTGCTGTTTATATATATATATATT

ATATATAAATATCTATTTATCTGTCTGAGCCCTACCTTCACCCACTCCTCCATGCACTAGGGGCCCAGTCCTGAATGGGCTCCTCCCTACCCCTGACCTT

GCACTCCTCAGCCCCTATCGGTTCCCCAGCCCTGTCCCGTGATGTAAGGGGGCTCTAGAAAGGGGACAGGAAGGGGGCCAGACCTTGGCTGCATGGAGTG

GGTCGATGTGACTTTTTCCCCCTTCCTTCTCTCCCTCTGCCCCTCCTAACTCTAGCCTTGGTTCCTCCAGCATCGCCTGAACTTAAGAAGCTCTCAAATG

GAAATTCAACCCCAAGAGTAGAGGGGTGGAGGTGGCTTGGATGAAATGGGTGGAGAGGAGATGGCCTCTGTAGAGAGAGGACCAGTCAGCCAAAAGTTGA

ATTCCACACATACTGGATGTGGAGCCTAAAAGGGAAGTGGTGTCCTACACCATTCTGGAATGGGGCTAAAAGGGACTGGGGAGAGGGGTACTAGGAGGGG

TGTGGCTTAAACACATGGTGGGTTCCGGAGTGGGCAGGTTTGGGTTGGATCCAGCATCTCTAGAAGGGGTGTGTCTTGGAACATTCAGGAGTTTGAGCTT

GATTCCAAAGAGCTTGAGCAAGGCTAGAAGTGGGATTCGGGAATGATCTAAGCTTGAGAGAAGGTTCTGGTCAGGATTGCAGACAGGCAGGTGAAGAGGA

CGAGGGATGTGTGGTGCTCTCAGAAGAGGAAGCCCATTCTGTAATGGGGCAGAAAAGAAAATACGGTTTCAGTTGAGTGGAGTTTGAGCAGTGGGTGTAG

GAGGCCATGGTTGGGAGCTGTGAGGTGAGTTTTGCTAAAAGTAGGAAGGAGTACTCCTGATTCCACCCCACGCCCCAGAACGGACATAACCTGGGAAGAG

CCAAGTATTGTGGTTTGGAGGGTGAGCGAAATGTCCCTTACTGACTCCCTCAGAAGAGGGCTAGATAATCAGAAGACAGAATCTACAGGTCTGTGGGGCT

GGCCTACCTTCTCCACCCTTTCTCTGCCCTCTCCCTCCACACTCCCGTCTGTCCCGGAGCACTGGGAGGCTGGCTCTGGAGCCCCAATCCTGGACCCTCT

GCTGTGTCTGTGACGTTGGTAGTGCCTGTGATCGTGTGTTGCCATTTTGTCTGACTGTGGCCCCTCCCTTTTCCCTCCAGACCCCCTACTTTCCTGTGCC

CTTCGGTATTGTTTGAAGACCCCCCTCCCCAAGGAAGAGCAAATATGAGAACCCCCCCCAATAAACTCCTCAACTATC
Translation
MDVVNQ LVAGGQFRVVKEPLGFVKVLQW VFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFR RLHQVYFDAPSCVKGGTTKIFLVGDYS

SSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMM DFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSG

LNTSV - UNI32187 - VFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGG

GGYGPQGDYGQQGYGQQGAPTSFSNQM - UNI19565 - 
Transcript ENSMUST00000116637
Sequence
ATTGCTGATGCTGCTGCTGGCAGACATGGACGTGGTGAATCAG CTGGTGGCTGGGGGTCAGTTCCGGGTGGTCAAGGAGCCCCTTGGCTTCGTGAAGGT

GCTGCAGTGG GTCTTTGCCATCTTCGCCTTTGCTACGTGCGGCAGCTACACCGGAGAGCTTCGGCTGAGCGTGGAGTGTGCCAACAAGACGGAGAGTGC

CCTCAACATCGAAGTCGAATTTGAGTACCCATTCAG GCTGCACCAAGTGTACTTTGATGCACCCTCCTGCGTTAAAGGGGGCACTACCAAGATCTTCCT

AGTTGGTGACTACTCCTCCTCGGCTGAATTCTTTGTCACCGTGGCTGTGTTTGCCTTCCTCTACTCCATGGGGGCCCTGGCCACCTACATCTTCCTGCAG

AACAAGTACCGAGAGAACAACAAAGGGCCAATGATG GACTTCCTGGCCACAGCAGTGTTCGCTTTCATGTGGCTAGTTAGCTCATCCGCCTGGGCCAAA

GGCCTGTCCGATGTGAAGATGGCCACTGACCCAGAGAACATTATCAAGGAGATGCCTATGTGCCGCCAGACAGGAAACACATGCAAGGAACTGAGGGACC

CTGTGACTTCAGGACTCAACACCTCGGTG - UNI32187 - GTGTTTGGCTTCCTGAACCTGGTGCTCTGGGTTGGCAACCTATGGTTCGTGTTCAAG

GAGACAGGCTGGGCCGCCCCATTCATGCGCGCACCTCCAGGCGCCCCAGAAAAGCAACCAGCTCCTGGCGATGCCTACGGCGATGCGGGCTATGGGCAGG

GCCCCGGAGGCTATGGGCCCCAGGACTCCTACGGGCCTCAGGGTGGTTATCAACCCGATTACGGGCAGCCAGCCAGCGGCGGTGGCGGTGGCTACGGGCC

TCAGGGCGACTATGGGCAGCAAGGCTACGGCCAACAGGGTGCGCCCACCTCCTTCTCCAATCAGATGTAATCTG - UNI19565 - GTCAGTGAAGCC

CACGAAGACCCCACGGGTGGGCAAGAGCTCAAGAGAAGGCCTGCCCCCCTTCCCATCCCCATATCCTAGGTCTCCACCCCTCAACCCAGGAGACCCTGTC

TTTGCTGTTTATATATATATATATTATATATAAATATCTATTTATCTGTCTGAGCCCTACCTTCACCCACTCCTCCATGCACTAGGGGCCCAGTCCTGAA

TGGGCTCCTCCCTACCCCTGACCTTGCACTCCTCAGCCCCTATCGGTTCCCCAGCCCTGTCCCGTGATGTAAGGGGGCTCTAGAAAGGGGACAGGAAGGG

GGCCAGACCTTGGCTGCATGGAGTGGGTCGATGTGACTTTTTCCCCCTTCCTTCTCTCCCTCTGCCCCTCCTAACTCTAGCCTTGGTTCCTCCAGCATCG

CCTGAACTTAAGAAGCTCTCAAATGGAAATTCAACCCCAAGAGTAGAGGGGTGGAGGTGGCTTGGATGAAATGGGTGGAGAGGAGATGGCCTCTGTAGAG

AGAGGACCAGTCAGCCAAAAGTTGAATTCCACACATACTGGATGTGGAGCCTAAAAGGGAAGTGGTGTCCTACACCATTCTGGAATGGGGCTAAAAGGGA

CTGGGGAGAGGGGTACTAGGAGGGGTGTGGCTTAAACACATGGTGGGTTCCGGAGTGGGCAGGTTTGGGTTGGATCCAGCATCTCTAGAAGGGGTGTGTC

TTGGAACATTCAGGAGTTTGAGCTTGATTCCAAAGAGCTTGAGCAAGGCTAGAAGTGGGATTCGGGAATGATCTAAGCTTGAGAGAAGGTTCTGGTCAGG

ATTGCAGACAGGCAGGTGAAGAGGACGAGGGATGTGTGGTGCTCTCAGAAGAGGAAGCCCATTCTGTAATGGGGCAGAAAAGAAAATACGGTTTCAGTTG

AGTGGAGTTTGAGCAGTGGGTGTAGGAGGCCATGGTTGGGAGCTGTGAGGTGAGTTTTGCTAAAAGTAGGAAGGAGTACTCCTGATTCCACCCCACGCCC

CAGAACGGACATAACCTGGGAAGAGCCAAGTATTGTGGTTTGGAGGGTGAGCGAAATGTCCCTTACTGACTCCCTCAGAAGAGGGCTAGATAATCAGAAG

ACAGAATCTACAGGTCTGTGGGGCTGGCCTACCTTCTCCACCCTTTCTCTGC CCCCTCCCTTTTCCCTCCAGACCCCCTACTTTCCTGTGCCCTTCGGT

ATTGTTTGAAGACCCCCCTCCCCAAGGAAGAGCAAATATGAGAACCCCCCCCAATAAACTCCTCAACTATC
Translation
MDVVNQ LVAGGQFRVVKEPLGFVKVLQW VFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFR RLHQVYFDAPSCVKGGTTKIFLVGDYS

SSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMM DFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELRDPVTSG

LNTSV - UNI32187 - VFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPASGGG

GGYGPQGDYGQQGYGQQGAPTSFSNQM - UNI19565 -  
Transcript ENSMUST00000069520
Sequence
AGAGTCTCTAGCCTCCCGAATGGAATGGCCGCAGGCGAGTTGGGGCGGGCGAGGAGTATGGGGCGGGGGGGAGCCATGGTGCGCAGGCGCTTGCTCAAAA

GATAGGCAGGGTGCAAGGGGCGTGGCTGCCGCCGACTGGGCTGTTCCGACGATCGCGCACCGCCCCCGCCGCTCCCCGCGCCCGCCCTTGCTACCAGGCA

CCTTCCGCCCCCCGCATTGCTGATGCTGCTGCTGGCAGACATGGACGTGGTGAATCAG CTGGTGGCTGGGGGTCAGTTCCGGGTGGTCAAGGAGCCCCT

TGGCTTCGTGAAGGTGCTGCAGTGG GTCTTTGCCATCTTCGCCTTTGCTACGTGCGGCAGCTACACCGGAGAGCTTCGGCTGAGCGTGGAGTGTGCCAA

CAAGACGGAGAGTGCCCTCAACATCGAAGTCGAATTTGAGTACCCATTCAG GCTGCACCAAGTGTACTTTGATGCACCCTCCTGCGTTAAAGGGGGCAC

TACCAAGATCTTCCTAGTTGGTGACTACTCCTCCTCGGCTGAATTCTTTGTCACCGTGGCTGTGTTTGCCTTCCTCTACTCCATGGGGGCCCTGGCCACC

TACATCTTCCTGCAGAACAAGTACCGAGAGAACAACAAAGGGCCAATGATG GACTTCCTGGCCACAGCAGTGTTCGCTTTCATGTGGCTAGTTAGCTCA

TCCGCCTGGGCCAAAGGCCTGTCCGATGTGAAGATGGCCACTGACCCAGAGAACATTATCAAGGAGATGCCTATGTGCCGCCAGACAGGAAACACATGCA

AGGAACTGAGGGACCCTGTGACTTCAGGACTCAACACCTCGGTG - UNI32187 - GTGTTTGGCTTCCTGAACCTGGTGCTCTGGGTTGGCAACCTA

TGGTTCGTGTTCAAGGAGACAGGCTGGGCCGCCCCATTCATGCGCGCACCTCCAGGCGCCCCAGAAAAGCAACCAGCTCCTGGCGATGCCTACGGCGATG

CGGGCTATGGGCAGGGCCCCGGAGGCTATGGGCCCCAGGACTCCTACGGGCCTCAGGGTGGTTATCAACCCGATTACGGGCAGCCAGCCAGCGGCGGTGG

CGGTGGCTACGGGCCTCAGGGCGACTATGGGCAGCAAGGCTACGGCCAACAGGGTGCGCCCACCTCCTTCTCCAATCAGATGTAATCTG - UNI19565

 - GTCAGTGAAGCCCACGAAGACCCCACGGGTGGGCAAGAGCTCAAGAGAAGGCCTGCCCCCCTTCCCATCCCCATATCCTAGGTCTCCACCCCTCAAC

CCAGGAGACCCTGTCTTTGCTGTTTATATATATATATATTATATATAAATATCTATTTATCTGTCTGAGCCCTACCTTCACCCACTCCTCCATGCACTAG

GGGCCCAGTCCTGAATGGGCTCCTCCCTACCCCTGACCTTGCACTCCTCAGCCCCTATCGGTTCCCCAGCCCTGTCCCGTGATGTAAGGGGGCTCTAGAA

AGGGGACAGGAAGGGGGCCAGACCTTGGCTGCATGGAGTGGGTCGATGTGACTTTTTCCCCCTTCCTTCTCTCCCTCTGCCCCTCCTAACTCTAGCCTTG

GTTCCTCCAGCATCGCCTGAACTTAAGAAGCTCTCAAATGGAAATTCAACCCCAAGAGTAGAGGGGTGGAGGTGGCTTGGATGAAATGGGTGGAGAGGAG

ATGGCCTCTGTAGAGAGAGGACCAGTCAGCCAAAAGTTGAATTCCACACATACTGGATGTGGAGCCTAAAAGGGAAGTGGTGTCCTACACCATTCTGGAA

TGGGGCTAAAAGGGACTGGGGAGAGGGGTACTAGGAGGGGTGTGGCTTAAACACATGGTGGGTTCCGGAGTGGGCAGGTTTGGGTTGGATCCAGCATCTC

TAGAAGGGGTGTGTCTTGGAACATTCAGGAGTTTGAGCTTGATTCCAAAGAGCTTGAGCAAGGCTAGAAGTGGGATTCGGGAATGATCTAAGCTTGAGAG

AAGGTTCTGGTCAGGATTGCAGACAGGCAGGTGAAGAGGACGAGGGATGTGTGGTGCTCTCAGAAGAGGAAGCCCATTCTGTAATGGGGCAGAAAAGAAA

ATACGGTTTCAGTTGAGTGGAGTTTGAGCAGTGGGTGTAGGAGGCCATGGTTGGGAGCTGTGAGGTGAGTTTTGCTAAAAGTAGGAAGGAGTACTCCTGA

TTCCACCCCACGCCCCAGAACGGACATAACCTGGGAAGAGCCAAGTATTGTGGTTTGGAGGGTGAGCGAAATGTCCCTTACTGACTCCCTCAGAAGAGGG

CTAGATAATCAGAAGACAGAATCTACAGGTCTGTGGGGCTGGCCTACCTTCTCCACCCTTTCTCTGCCCTCTCCCTCCACACTCCCGTCTGTCCCGGAGC

ACTGGGAGGCTGGCTCTGGAGCCCCAATCCTGGACCCTCTGCTGTGTCTGTGACGTTGGTAGTGCCTGTGATCGTGTGTTGCCATTTTGTCTGACTGTGG

CCCCTCCCTTTTCCCTCCAGACCCCCTACTTTCCTGTGCCCTTCGGTATTGTTTGAAGACCCCCCTCCCCAAGGAAGAGCAAATATGAGAACCCCCCCCA

ATAAACTCCTCAACTATCTAGTC
Translation
MLLLADMDVVNQ LVAGGQFRVVKEPLGFVKVLQW VFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFR RLHQVYFDAPSCVKGGTTKIF

LVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMM DFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELR

DPVTSGLNTSV - UNI32187 - VFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ

PASGGGGGYGPQGDYGQQGYGQQGAPTSFSNQM - UNI19565 - 
Transcript ENSMUST00000116638
Sequence
ATTGCTGATGCTGCTGCTGGCAGACATGGACGTGGTGAATCAG CTGGTGGCTGGGGGTCAGTTCCGGGTGGTCAAGGAGCCCCTTGGCTTCGTGAAGGT

GCTGCAGTGG GTCTTTGCCATCTTCGCCTTTGCTACGTGCGGCAGCTACACCGGAGAGCTTCGGCTGAGCGTGGAGTGTGCCAACAAGACGGAGAGTGC

CCTCAACATCGAAGTCGAATTTGAGTACCCATTCAG GCTGCACCAAGTGTACTTTGATGCACCCTCCTGCGTTAAAGGGGGCACTACCAAGATCTTCCT

AGTTGGTGACTACTCCTCCTCGGCTGAATTCTTTGTCACCGTGGCTGTGTTTGCCTTCCTCTACTCCATGGGGGCCCTGGCCACCTACATCTTCCTGCAG

AACAAGTACCGAGAGAACAACAAAGGGCCAATGATG GACTTCCTGGCCACAGCAGTGTTCGCTTTCATGTGGCTAGTTAGCTCATCCGCCTGGGCCAAA

GGCCTGTCCGATGTGAAGATGGCCACTGACCCAGAGAACATTATCAAGGAGATGCCTATGTGCCGCCAGACAGGAAACACATGCAAGGAACTGAGGGACC

CTGTGACTTCAGGACTCAACACCTCGGTG - UNI32187 - GTGTTTGGCTTCCTGAACCTGGTGCTCTGGGTTGGCAACCTATGGTTCGTGTTCAAG

GAGACAGGCTGGGCCGCCCCATTCATGCGCGCACCTCCAGGCGCCCCAGAAAAGCAACCAGCTCCTGGCGATGCCTACGGCGATGCGGGCTATGGGCAGG

GCCCCGGAGGCTATGGGCCCCAGGACTCCTACGGGCCTCAGGGTGGTTATCAACCCGATTACGGGCAGCCAGCCAGCGGCGGTGGCGGTGGCTACGGGCC

TCAGGGCGACTATGGGCAGCAAGGCTACGGCCAACAGGGTGCGCCCACCTCCTTCTCCAATCAGATGTAATCTG - UNI19565 - GTCAGTGAAGCC

CACGAAGACCCCACGGGTGGGCAAGAGCTCAAGAGAAGGCCTGCCCCCCTTCCCATCCCCATATCCTAGGTCTCCACCCCTCAACCCAGGAGACCCTGTC

TTTGCTGTTTATATATATATATATTATATATAAATATCTATTTATCTGTCTGAGCCCTACCTTCACCCACTCCTCCATGCACTAGGGGCCCAGTCCTGAA

TGGGCTCCTCCCTACCCCTGACCTTGCACTCCTCAGCCCCTATCGGTTCCCCAGCCCTGTCCCGTGATGTAAGGGGGCTCTAGAAAGGGGACAGGAAGGG

GGCCAGACCTTGGCTGCATGGAGTGGGTCGATGTGACTTTTTCCCCCTTCCTTCTCTCCCTCTGCCCCTCCTAACTCTAGCCTTGGTTCCTCCAGCATCG

CCTGAACTTAAGAAGCTCTCAAATGGAAATTCAACCCCAAGAGTAGAGGGGTGGAGGTGGCTTGGATGAAATGGGTGGAGAGGAGATGGCCTCTGTAGAG

AGAGGACCAGTCAGCCAAAAGTTGAATTCCACACATACTGGATGTGGAGCCTAAAAGGGAAGTGGTGTCCTACACCATTCTGGAATGGGGCTAAAAGGGA

CTGGGGAGAGGGGTACTAGGAGGGGTGTGGCTTAAACACATGGTGGGTTCCGGAGTGGGCAGGTTTGGGTTGGATCCAGCATCTCTAGAAGGGGTGTGTC

TTGGAACATTCAGGAGTTTGAGCTTGATTCCAAAGAGCTTGAGCAAGGCTAGAAGTGGGATTCGGGAATGATCTAAGCTTGAGAGAAGGTTCTGGTCAGG

ATTGCAGACAGGCAGGTGAAGAGGACGAGGGATGTGTGGTGCTCTCAGAAGAGGAAGCCCATTCTGTAATGGGGCAGAAAAGAAAATACGGTTTCAGTTG

AGTGGAGTTTGAGCAGTGGGTGTAGGAGGCCATGGTTGGGAGCTGTGAGGTGAGTTTTGCTAAAAGTAGGAAGGAGTACTCCTGATTCCACCCCACGCCC

CAGAACGGACATAACCTGGGAAGAGCCAAGTATTGTGGTTTGGAGGGTGAGCGAAATGTCCCTTACTGACTCCCTCAGAAGAGGGCTAGATAATCAGAAG

ACAGAATCTACAGGTCTGTGGGGCTGGCCTACCTTCTCCACCCTTTCTCTGC CCCCTCCCTTTTCCCTCCAGACCCCCTACTTTCCTGTGCCCTTCGGT

ATTGTTTGAAGACCCCCCTCCCCAAGGAAGAGCAAATATGAGAACCCCCCCCAATAAACTCCTCAACTATC
Translation
MLLLADMDVVNQ LVAGGQFRVVKEPLGFVKVLQW VFAIFAFATCGSYTGELRLSVECANKTESALNIEVEFEYPFR RLHQVYFDAPSCVKGGTTKIF

LVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMM DFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPMCRQTGNTCKELR

DPVTSGLNTSV - UNI32187 - VFGFLNLVLWVGNLWFVFKETGWAAPFMRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ

PASGGGGGYGPQGDYGQQGYGQQGAPTSFSNQM - UNI19565 -  

For any suggestions or comments, please send an email to unitrap@crg.es