Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031147 (Magix)
Chromosomal location
Chr X: 7251754 - 7258350 (-)
Description
MAGI family member, X-linked Gene [Source:MGI (curated);Acc:Magix-001]
RefSeq_dna
NM_018832 
RefSeq_peptide
NP_061302.2 
UniGene
Mm.67912 
MGI
MGI:1859644 
Uniprot/SWISSPROT
Q4KL35 
Uniprot/SPTREMBL
Q3TZ57 
Human Ortholog
ENSG00000017621 (MAGIX)
Omim not available
UniTrap UNI17014
Vector Insertion
Chr X: 7257173 - 7258075
Public Clones not available
Private Clones OST450885 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22512
Vector Insertion
Chr X: 7254329 - 7257025
Public Clones not available
Private Clones OST294723 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24083
Vector Insertion
Chr X: 7253463 - 7254245
Public Clones not available
Private Clones OST235510 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29306
Vector Insertion
Chr X: 7252318 - 7252966
Public Clones CMHD-GT_424C3-3 (cmhd) PSTVUpb20d4 (vanderbilt) IST14154H5 (tigm) IST14564G3 (tigm)
IST13663C1 (tigm) IST12230F9 (tigm) IST14445G11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115695
Sequence
TCCAGGCCTGGGCTAGGAGCCAGGTGAGCGCGCCCCTGCGCTAAAAACTAATCATCGGGCTGCCCTGAGTCCACCAGGTTCACCACAGGCCATGGACTCT

CGCGCTGGGAACACGGCAGACCCTAGAGGGGGCAGAAGAG - UNI17014 - GAGGTGGCTTACAAGGGTCCAGGAGTCCCCGAGCTCGGCAGCTCCT

GGAGCGGCTGGATGCGCGCCCCCTGGCGGCACGAGCCGCCGCGGACTTGACAGCGCTAGTACGAAAAGCGGGCGCCACATTGCGCCTGCGCCACACGGAG

G - UNI22512 - GTGTTAGTGGTCTGGATTCTGCAGATATAGAAGTCACAGACAGTCGCTTGCCTCATGCTACTCTTGTGAAACATCGACCCCAG -

 UNI24083 - CATCAAAGGTCTGAGACTCTAGGTACATGGACGGAGCCACTTCCAGTAACCCAGAATAAGGCAAGCTATGCTTTGAAAGTACCCCAAG

CCACTGGCCGATTTTCTGTGGAGCTGACCCGAGGTCCGGCAGGTTTTGGTCTCACTTTAAGTGGAGGCCGAAATGTATCTGGGGATGCTCCATTGACCGT

GCATGGACTGCTGAAGGATGGGCCAGCACAGCGATGTGGTCGTTTGCAG GCTGGTGACCTCGTGCTCTATATCAATGGCCAGTCAACACAGGGCCTTAC

TCATGCCCAGGTGGTGGAGAGGATTCGAACTGGAGGCCCCCACCTTTGCCTGGTACTTCAAAGGCCTCAAGACATGGATGGCAGTAGGATCAAGGAGGTT

GGAGGACATCGGAAGACAG - UNI29306 - ATCGCAGCCTAGATCCTAGGGGAAGCAGGGTGGAGTCTCGCAGCACCATTTCCCCAGTTCACCACCG

GCCCAAGACCCGGACCAGTCCCAGACCTAGTCCAGAGGCAGTGGCTATTGGCCACGTGGTTCGCGCAGTGGAGCACCCCACAGAAGACCTGGAAAACCGT

ATCCCTGGTACCCCTGGGCCCTGGCTGGTGCCCAGCGAGGACCGGCTCTCGCGGGCTCTAGGGGTTCGGGGTGGGGGCGCGCAGCTTGCTCTGGAGATGG

CAGCCGGAAGGCGGAGGCATTGAGCACCAATAGACAGCTTTGTGCTCACTAGGTGAGGTCCCATAAGGTTCTAGCATGCAGGACCGCCAGGCTCTAAGCT

TTTCCCTTAGAGCTTTAACCTGGTTTAGTACCTTCCCACTGCACATTGCACAGTGGAGTGGTCCCCACCCCTTCAAGACGCCAGTGGTATGGCCCTCCCA

GAGCCCAGAGCGCTCGCACCCCACCACCCCCACGTCCGCGTGCGCGCAGCTTCTCCTAGTCCCTTCCCGACCGGGAGGTAATAAAATAGTTGGATCC
Translation
MDSRAGNTADPRGGRRG - UNI17014 - GGGLQGSRSPRARQLLERLDARPLAARAAADLTALVRKAGATLRLRHTEG - UNI22512 - GVSGL

DSADIEVTDSRLPHATLVKHRPQ - UNI24083 - HQRSETLGTWTEPLPVTQNKASYALKVPQATGRFSVELTRGPAGFGLTLSGGRNVSGDAPLTV

HGLLKDGPAQRCGRLQ AGDLVLYINGQSTQGLTHAQVVERIRTGGPHLCLVLQRPQDMDGSRIKEVGGHRKTD - UNI29306 - DRSLDPRGSRVE

SRSTISPVHHRPKTRTSPRPSPEAVAIGHVVRAVEHPTEDLENRIPGTPGPWLVPSEDRLSRALGVRGGGAQLALEMAAGRRRH
Transcript ENSMUST00000033487
Sequence
AGCAGATGTACTTGGGGCAAAGCAAGGCTAGACTCTGACTTTACAGCTCCCGCAACCAGGCCTCCTTGCCTGCGGCCAG - UNI17014 - GAGGTGG

CTTACAAGGGTCCAGGAGTCCCCGAGCTCGGCAGCTCCTGGAGCGGCTGGATGCGCGCCCCCTGGCGGCACGAGCCGCCGCGGACTTGACAGCGCTAGTA

CGAAAAGCGGGCGCCACATTGCGCCTGCGCCACACGGAGG - UNI22512 - GTGTTAGTGGTCTGGATTCTGCAGATATAGAAGTCACAGACAGTCG

CTTGCCTCATGCTACTCTTGTGAAACATCGACCCCAG - UNI24083 - CATCAAAGGTCTGAGACTCTAGGTACATGGACGGAGCCACTTCCAGTAA

CCCAGAATAAGGCAAGCTATGCTTTGAAAGTACCCCAAGCCACTGGCCGATTTTCTGTGGAGCTGACCCGAGGTCCGGCAGGTTTTGGTCTCACTTTAAG

TGGAGGCCGAAATGTATCTGGGGATGCTCCATTGACCGTGCATGGACTGCTGAAGGATGGGCCAGCACAGCGATGTGGTCGTTTGCAG GCTGGTGACCT

CGTGCTCTATATCAATGGCCAGTCAACACAGGGCCTTACTCATGCCCAGGTGGTGGAGAGGATTCGAACTGGAGGCCCCCACCTTTGCCTGGTACTTCAA

AGGCCTCAAGACATGGATGGCAGTAGGATCAAGGAGGTTGGAGGACATCGGAAGACAG - UNI29306 - ATCGCAGCCTAGATCCTAGGGGAAGCAG

GGTGGAGTCTCGCAGCACCATTTCCCCAGTTCACCACCGGCCCAAGACCCGGACCAGTCCCAGACCTAGTCCAGAGGCAGTGGCTATTGGCCACGTGGTT

CGCGCAGTGGAGCACCCCACAGAAGACCTGGAAAACCGTATCCCTGGTACCCCTGGGCCCTGGCTGGTGCCCAGCGAGGACCGGCTCTCGCGGGCTCTAG

GGGTTCGGGGTGGGGGCGCGCAGCTTGCTCTGGAGATGGCAGCCGGAAGGCGGAGGCATTGAGCACCAATAGACAGCTTTGTGCTCACTAGGTGAGGTCC

CATAAGGTTCTAGCATGCAGGACCGCCAGGCTCTAAGCTTTTCCCTTAGAGCTTTAACCTGGTTTAGTACCTTCCCACTGCACATTGCACAGTGGAGTGG

TCCCCACCCCTTCAAGACGCCAGTGGTATGGCCCTCCCAGAGCCCAGAGCGCTCGCACCCCACCACCCCCACGTCCGCGTGCGCGCAGCTTCTCCTAGTC

CCTTCCCGACCGGGAGGTAATAAAATAGTTGGATCC
Translation
SRCTWGKARLDSDFTAPATRPPCLRPG - UNI17014 - GGGLQGSRSPRARQLLERLDARPLAARAAADLTALVRKAGATLRLRHTEG - UNI225

12 - GVSGLDSADIEVTDSRLPHATLVKHRPQ - UNI24083 - HQRSETLGTWTEPLPVTQNKASYALKVPQATGRFSVELTRGPAGFGLTLSGGR

NVSGDAPLTVHGLLKDGPAQRCGRLQ AGDLVLYINGQSTQGLTHAQVVERIRTGGPHLCLVLQRPQDMDGSRIKEVGGHRKTD - UNI29306 - DR

SLDPRGSRVESRSTISPVHHRPKTRTSPRPSPEAVAIGHVVRAVEHPTEDLENRIPGTPGPWLVPSEDRLSRALGVRGGGAQLALEMAAGRRRH

For any suggestions or comments, please send an email to unitrap@crg.es