Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031153 (Gripap1)
Chromosomal location
Chr X: 7367119 - 7397687 (+)
Description
GRIP1 associated protein 1 Gene [Source:MGI (curated);Acc:Gripap1-002]
RefSeq_dna
NM_207670 
RefSeq_peptide
NP_997553.1 
UniGene
Mm.397240 
MGI
MGI:1859616 
Uniprot/SWISSPROT
Q8VD04 
Uniprot/SPTREMBL
A2AEW5 A2AEW6 Q3T9D9 Q3TZ55 A2AEW9 A2AEW7 A2AEW8 
Human Ortholog
ENSG00000068400 (GRIPAP1)
Omim not available
UniTrap UNI31015
Vector Insertion
Chr X: 7372226 - 7376415
Public Clones IST11174E10 (tigm) IST14248G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35885
Vector Insertion
Chr X: 7381621 - 7387018
Public Clones IST14518C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34924
Vector Insertion
Chr X: 7387848 - 7389407
Public Clones IST14888D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21745
Vector Insertion
Chr X: 7390058 - 7391693
Public Clones PSTVU01.HJ46 (vanderbilt)
Private Clones OST319066 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115671
Sequence
GCGCACAAAGCTTGCGGGGGATGGGGGGAGGAACATGGCGCAAGCTCTGTCTGAAGAGGAGTTTCAACGGATGCAG ACTCAGCTCCTGGAGCTCCGGAC

AAATAACTACCAGCTTTCGGATGAACTTCGGAAGAATGGTGTTG AACTTTCCAGTCTTCGACAGAAGGTCGCCTACCTGGATAAGGAGTTCAGTAAAGC

TCAAAAG - UNI31015 - CTTTGCAGCCAGCTGGAGCAGCTGGAGCTGGAAAACCGACAACTCAAGGAAGGCGTTCCTGGAGCAGCTGGAGCACATG

TGGACGGGGAGCTGCTGAGGCTGCAGGCAGAGAACACAGCCTTGCAGAAGAACATGGCAG CACTGCAGGAACGCTATGGGAAAGAGGCTGTGAGGCCCT

CTGCTGTTGGTGAGGGCCAAGGGGATCCCCCAGGAGACGTACTCCCCACTCCCCTGGCTCCCATGCCATTGGCAGAAGTGGAGCTGAAATGGGAAATGGA

GCGAGAAGAAAAAAAATTGCTCTGGGAGCAGCTACAAGGCTTAGAG CTCTCTGAGAAATTGAAAAAGAAACAAGAAAG TTTTTGCCGTCTGCAGACAG

AGAAGGAAACACTGTTTAATGACAGCAG AAACAAAATTGAAGAATTGCAACAGCGGAAGGAAGCTGATCTGAAAGCCCAGTTGGCTCGCACCCAAAAAC

TACAGCAGGAACTTGAGGCTGCCAATCAG AGTTTGGCAGAGCTAAGAGATCAGCGGCAGGGGGAGCGTCTGGAGCATGCAGCAGCGTTGCGGGCCCTAC

AAGATCAG ATCCAGACAGCAAAGACACAAGAACTGAATATGCTTCGGGAACAGACCAGTGAATTGGCATCTGAGTTACAGCATCGTCAAGCTGAATATG

AAGAGCTTATGGGACAGAAAGATGACCTCAACTCGCAGCTCCAG - UNI35885 - GAGTCGTTAAGGGCCAATAGCCGGCTGCTGGAACAACTTCAA

GAAATAGGGCAGGAGAAGGAGCAGCTAACCCAGGATCTCCAGGAAGCTCGGAAG AGTGCCGAGAAAAGGAAGGTCATGCTGGATGAACTAGCCATGGAG

ACGCTGCAGGAGAAGTCCCAGCACAAAGAAGAACTGGGGGCCGTCCGGTTACGGCACGAGAAGGAGCTGCTGGGCGTGCGAGCCCGATACGAGCGTGAGC

TTCGAGAACTGCACGAGGACAAGAAGCGGCAGGAGGAGGAGCTCCGGGGGCAGATTCGTGAGGAGAAG GCTCGAACAAGGGAATTAGAAAATCTTCAGC

ACACAGTGGAAGAACTCCAGGCTCAGGTACACTCCATGGATGGAGCCAAGGGCTGGTTTGAACGGCGCTTGAAGGAAGCTGAG - UNI34924 - GAA

TCTTTGCAGCAGCAGCAACAGGAACAAGAGGAAACCCTCAAGCTGTGCCGGGAGGAGCACGCCGCTGAGCTGAAG GGCAAGGATGAAGAGCTTCAGAAT

GTTCGGGAACAGCTCCAGCAGGCCCAGGAGGAGCGAGATGGCCACGTGAAGACCATCAGCAACCTGAAGCAG GAGGTAAAGGACACAGTAGACGGGCAG

CGCATCCTGGAGAAGAAAGGCAGCGCTGTG CTCAAAGATCTTAAGCGGCAGCTGCACTTGGAGCGGAAACGGGCTGATAAGCTGCAGGAACGGCTGCAG

GAGATCCTTACCAACAGCAAGAGCCGCACAG - UNI21745 - GCCTCGAGGAGCTGGTTCTGTCTGAGATGAACTCACCAAGCAGGACCCAGACAGG

GGACAGCAGTAGTGTCTCCTCCTTCAGCTACCGGGAGATCTTGAAGGAGAAGGAGAGTTCAGCCATCCCAGCCAGG TCTCTATCCAGCAGTCCTCAGGC

CCAGCCCCCTCGGCCAGCAGAGCTGTCAGATGAGGAAGTGGCTGAGCTGTTTCAGAGGCTGGCCGAGACTCAGCAGGAAAAATGGATGCTAGAGGAGAAG

 GTGAAACACCTGGAGGTGAGCAGCGCCTCTATGGCGGAAGATCTCTGCCGGAAAAGCGCCATCATTGAGACCTACGTCATGGACAGCCGGATTG ATGT

GTCTGTGGCAGCAGGCCACACAGACCGAAGTGGGCTGGGCAGTGTCCTGAGAGACCTAGTGAAGCCAGGCGATGAGAACCTTCGAGAAATGAACAAGAAG

CTGCAGAACATGTTGGAGGAGCAACTCACCAAGAACATGCACTTGCACAAG GACATGGAAGTTCTATCCCAGGAAATTGTGCGGCTCAGCAAGGAATGT

GTGGGGTCCCCTGACCCAGACCTAGAACCTGGAGAAGCCAACTAAAGACCTACAGGATGCAACTATTCCCAATCCTTTCCAGAATGTCACTCACTCCCTT

GGGCTGTTGTGGGAAAATATGGAGGCTGGCACCAAATTTCATAGTTTGGGAGATGGACATTAAAGGGGCTAGAGGCCTATATGTGGCTGGTGTTGGTGAC

CCTGATGTATGGCAGAGCCCTTGGGGAGAAGAGACCCTGAGGGAAGGGCAAGGCTTTTCCTTTTTGGCTCTGGTTCCCAGGGTCATCCGCCTTCAACTCT

GCATGAGATCTCCCTCCTAGAGACCAACTCTGTTTCATTTTATTTTATTTTTTAATTTATGTCTGGAAGCCTGGCTAAACTCTGCCTTCGGGACTGGGGG

TATTGGGTGGGGGTGCAGTCCATGTTCAATGTTCCAGCAACGTGTGTATGTGTGTGAGTATGTGTGTAAAGACTATGTGGCCAAAATACCATCTGGCCAG

ACGGGCCCACCC
Translation
MAQALSEEEFQRMQ TQLLELRTNNYQLSDELRKNGVE ELSSLRQKVAYLDKEFSKAQK - UNI31015 - LCSQLEQLELENRQLKEGVPGAAGAH

VDGELLRLQAENTALQKNMAA ALQERYGKEAVRPSAVGEGQGDPPGDVLPTPLAPMPLAEVELKWEMEREEKKLLWEQLQGLE LSEKLKKKQES SFC

RLQTEKETLFNDSR RNKIEELQQRKEADLKAQLARTQKLQQELEAANQ SLAELRDQRQGERLEHAAALRALQDQ IQTAKTQELNMLREQTSELASEL

QHRQAEYEELMGQKDDLNSQLQ - UNI35885 - ESLRANSRLLEQLQEIGQEKEQLTQDLQEARK SAEKRKVMLDELAMETLQEKSQHKEELGAVR

LRHEKELLGVRARYERELRELHEDKKRQEEELRGQIREEK ARTRELENLQHTVEELQAQVHSMDGAKGWFERRLKEAE - UNI34924 - ESLQQQQ

QEQEETLKLCREEHAAELK GKDEEL   - UNI21745 -     
Transcript ENSMUST00000101694
Sequence
GCGCACAAAGCTTGCGGGGGATGGGGGGAGGAACATGGCGCAAGCTCTGTCTGAAGAGGAGTTTCAACGGATGCAG ACTCAGCTCCTGGAGCTCCGGAC

AAATAACTACCAGCTTTCGGATGAACTTCGGAAGAATGGTGTTG AACTTTCCAGTCTTCGACAGAAGGTCGCCTACCTGGATAAGGAGTTCAGTAAAGC

TCAAAAG - UNI31015 - CTTTGCAGCCAGCTGGAGCAGCTGGAGCTGGAAAACCGACAACTCAAGGAAGGCGTTCCTGGAGCAGCTGGAGCACATG

TGGACGGGGAGCTGCTGAGGCTGCAGGCAGAGAACACAGCCTTGCAGAAGAACATGGCAG CACTGCAGGAACGCTATGGGAAAGAGGCTGTGAGGCCCT

CTGCTGTTGGTGAGGGCCAAGGGGATCCCCCAGGAGACGTACTCCCCACTCCCCTGGCTCCCATGCCATTGGCAGAAGTGGAGCTGAAATGGGAAATGGA

GCGAGAAGAAAAAAAATTGCTCTGGGAGCAGCTACAAGGCTTAGAG AGCTCAAAGCAAGCTGAAACCTCCAGACTACAGGAGGAACTTGCTAAG CTCT

CTGAGAAATTGAAAAAGAAACAAGAAAG TTTTTGCCGTCTGCAGACAGAGAAGGAAACACTGTTTAATGACAGCAG AAACAAAATTGAAGAATTGCAA

CAGCGGAAGGAAGCTGATCTGAAAGCCCAGTTGGCTCGCACCCAAAAACTACAGCAGGAACTTGAGGCTGCCAATCAG AGTTTGGCAGAGCTAAGAGAT

CAGCGGCAGGGGGAGCGTCTGGAGCATGCAGCAGCGTTGCGGGCCCTACAAGATCAG GTGTCCAGCCAGAGTGCAGATGCGCAGGAACAAGTGGAAGGG

CTCTTGGCTGAGAACAGTGCCTTGAGGACTAGCTTGGCTGCTCTGGAGCAG ATCCAGACAGCAAAGACACAAGAACTGAATATGCTTCGGGAACAGACC

AGTGAATTGGCATCTGAGTTACAGCATCGTCAAGCTGAATATGAAGAGCTTATGGGACAGAAAGATGACCTCAACTCGCAGCTCCAG - UNI35885 -

 GAGTCGTTAAGGGCCAATAGCCGGCTGCTGGAACAACTTCAAGAAATAGGGCAGGAGAAGGAGCAGCTAACCCAGGATCTCCAGGAAGCTCGGAAG AG

TGCCGAGAAAAGGAAGGTCATGCTGGATGAACTAGCCATGGAGACGCTGCAGGAGAAGTCCCAGCACAAAGAAGAACTGGGGGCCGTCCGGTTACGGCAC

GAGAAGGAGCTGCTGGGCGTGCGAGCCCGATACGAGCGTGAGCTTCGAGAACTGCACGAGGACAAGAAGCGGCAGGAGGAGGAGCTCCGGGGGCAGATTC

GTGAGGAGAAG GCTCGAACAAGGGAATTAGAAAATCTTCAGCACACAGTGGAAGAACTCCAGGCTCAGGTACACTCCATGGATGGAGCCAAGGGCTGGT

TTGAACGGCGCTTGAAGGAAGCTGAG - UNI34924 - GAATCTTTGCAGCAGCAGCAACAGGAACAAGAGGAAACCCTCAAGCTGTGCCGGGAGGAG

CACGCCGCTGAGCTGAAG GGCAAGGATGAAGAGCTTCAGAATGTTCGGGAACAGCTCCAGCAGGCCCAGGAGGAGCGAGATGGCCACGTGAAGACCATC

AGCAACCTGAAGCAG GAGGTAAAGGACACAGTAGACGGGCAGCGCATCCTGGAGAAGAAAGGCAGCGCTGTG CTCAAAGATCTTAAGCGGCAGCTGCA

CTTGGAGCGGAAACGGGCTGATAAGCTGCAGGAACGGCTGCAGGAGATCCTTACCAACAGCAAGAGCCGCACAG - UNI21745 - GCCTCGAGGAGC

TGGTTCTGTCTGAGATGAACTCACCAAGCAGGACCCAGACAGGGGACAGCAGTAGTGTCTCCTCCTTCAGCTACCGGGAGATCTTGAAGGAGAAGGAGAG

TTCAGCCATCCCAGCCAGG TCTCTATCCAGCAGTCCTCAGGCCCAGCCCCCTCGGCCAGCAGAGCTGTCAGATGAGGAAGTGGCTGAGCTGTTTCAGAG

GCTGGCCGAGACTCAGCAGGAAAAATGGATGCTAGAGGAGAAG GTGAAACACCTGGAGGTGAGCAGCGCCTCTATGGCGGAAGATCTCTGCCGGAAAAG

CGCCATCATTGAGACCTACGTCATGGACAGCCGGATTG ATGTGTCTGTGGCAGCAGGCCACACAGACCGAAGTGGGCTGGGCAGTGTCCTGAGAGACCT

AGTGAAGCCAGGCGATGAGAACCTTCGAGAAATGAACAAGAAGCTGCAGAACATGTTGGAGGAGCAACTCACCAAGAACATGCACTTGCACAAG GACAT

GGAAGTTCTATCCCAGGAAATTGTGCGGCTCAGCAAGGAATGTGTGGGGTCCCCTGACCCAGACCTAGAACCTGGAGAAGCCAACTAAAGACCTACAGGA

TGCAACTATTCCCAATCCTTTCCAGAATGTCACTCACTCCCTTGGGCTGTTGTGGGAAAATATGGAGGCTGGCACCAAATTTCATAGTTTGGGAGATGGA

CATTAAAGGGGCTAGAGGCCTATATGTGGCTGGTGTTGGTGACCCTGATGTATGGCAGAGCCCTTGGGGAGAAGAGACCCTGAGGGAAGGGCAAGGCTTT

TCCTTTTTGGCTCTGGTTCCCAGGGTCATCCGCCTTCAACTCTGCATGAGATCTCCCTCCTAGAGACCAACTCTGTTTCATTTTATTTTATTTTTTAATT

TATGTCTGGAAGCCTGGCTAAACTCTGCCTTCGGGACTGGGGGTATTGGGTGGGGGTGCAGTCCATGTTCAATGTTCCAGCAACGTGTGTATGTGTGTGA

GTATGTGTGTAAAGACTATGTGGCCAAAATACCATCTGGCCAGACGGGCCCACCC
Translation
MAQALSEEEFQRMQ TQLLELRTNNYQLSDELRKNGVE ELSSLRQKVAYLDKEFSKAQK - UNI31015 - LCSQLEQLELENRQLKEGVPGAAGAH

VDGELLRLQAENTALQKNMAA ALQERYGKEAVRPSAVGEGQGDPPGDVLPTPLAPMPLAEVELKWEMEREEKKLLWEQLQGLE SSKQAETSRLQEELA

K LSEKLKKKQES SFCRLQTEKETLFNDSR RNKIEELQQRKEADLKAQLARTQKLQQELEAANQ SLAELRDQRQGERLEHAAALRALQDQ VSSQSA

DAQEQVEGLLAENSALRTSLAALEQ IQTAKTQELNMLREQTSELASELQHRQAEYEELMGQKDDLNSQLQ - UNI35885 - ESLRANSRLLEQLQE

IGQEKEQLTQDLQEARK SAEKRKVMLDELAMETLQEKSQHKEELGAVRLRHEKELLGVRARYERELRELHEDKKRQEEELRGQIREEK ARTRELENLQ

HTVEELQAQVHSMDGAKGWFERRLKEAE - UNI34924 - ESLQQQQQEQEETLKLCREEHAAELK GKDEELQNVREQLQQAQEERDGHVKTISNLK

Q EVKDTVDGQRILEKKGSAV LKDLKRQLHLERKRADKLQERLQEILTNSKSRTG - UNI21745 - GLEELVLSEMNSPSRTQTGDSSSVSSFSYR

EILKEKESSAIPAR SLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEK VKHLEVSSASMAEDLCRKSAIIETYVMDSRID DVSVAAGHTD

RSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHK DMEVLSQEIVRLSKECVGSPDPDLEPGEAN
Transcript ENSMUST00000065932
Sequence
GCGCACAAAGCTTGCGGGGGATGGGGGGAGGAACATGGCGCAAGCTCTGTCTGAAGAGGAGTTTCAACGGATGCAG ACTCAGCTCCTGGAGCTCCGGAC

AAATAACTACCAGCTTTCGGATGAACTTCGGAAGAATGGTGTTG AACTTTCCAGTCTTCGACAGAAGGTCGCCTACCTGGATAAGGAGTTCAGTAAAGC

TCAAAAG GCACTAAGCAAGAGCAAGAAAGCTCAG GAAGTGGAGGTACTGCTGAGTGAAAATGAGATGCTGCAGGCAAAGCTGCACAGCCAGGAGGAGG

ACTTCCGTTTGCAGAACAGTACACTTATGGCCGAGTTCAGCAAG - UNI31015 - CTTTGCAGCCAGCTGGAGCAGCTGGAGCTGGAAAACCGACAA

CTCAAGGAAGGCGTTCCTGGAGCAGCTGGAGCACATGTGGACGGGGAGCTGCTGAGGCTGCAGGCAGAGAACACAGCCTTGCAGAAGAACATGGCAG CA

CTGCAGGAACGCTATGGGAAAGAGGCTGTGAGGCCCTCTGCTGTTGGTGAGGGCCAAGGGGATCCCCCAGGAGACGTACTCCCCACTCCCCTGGCTCCCA

TGCCATTGGCAGAAGTGGAGCTGAAATGGGAAATGGAGCGAGAAGAAAAAAAATTGCTCTGGGAGCAGCTACAAGGCTTAGAG AGCTCAAAGCAAGCTG

AAACCTCCAGACTACAGGAGGAACTTGCTAAG CTCTCTGAGAAATTGAAAAAGAAACAAGAAAG TTTTTGCCGTCTGCAGACAGAGAAGGAAACACTG

TTTAATGACAGCAG AAACAAAATTGAAGAATTGCAACAGCGGAAGGAAGCTGATCTGAAAGCCCAGTTGGCTCGCACCCAAAAACTACAGCAGGAACTT

GAGGCTGCCAATCAG AGTTTGGCAGAGCTAAGAGATCAGCGGCAGGGGGAGCGTCTGGAGCATGCAGCAGCGTTGCGGGCCCTACAAGATCAG ATCCA

GACAGCAAAGACACAAGAACTGAATATGCTTCGGGAACAGACCAGTGAATTGGCATCTGAGTTACAGCATCGTCAAGCTGAATATGAAGAGCTTATGGGA

CAGAAAGATGACCTCAACTCGCAGCTCCAG - UNI35885 - GAGTCGTTAAGGGCCAATAGCCGGCTGCTGGAACAACTTCAAGAAATAGGGCAGGA

GAAGGAGCAGCTAACCCAGGATCTCCAGGAAGCTCGGAAG AGTGCCGAGAAAAGGAAGGTCATGCTGGATGAACTAGCCATGGAGACGCTGCAGGAGAA

GTCCCAGCACAAAGAAGAACTGGGGGCCGTCCGGTTACGGCACGAGAAGGAGCTGCTGGGCGTGCGAGCCCGATACGAGCGTGAGCTTCGAGAACTGCAC

GAGGACAAGAAGCGGCAGGAGGAGGAGCTCCGGGGGCAGATTCGTGAGGAGAAG GCTCGAACAAGGGAATTAGAAAATCTTCAGCACACAGTGGAAGAA

CTCCAGGCTCAGGTACACTCCATGGATGGAGCCAAGGGCTGGTTTGAACGGCGCTTGAAGGAAGCTGAG - UNI34924 - GAATCTTTGCAGCAGCA

GCAACAGGAACAAGAGGAAACCCTCAAGCTGTGCCGGGAGGAGCACGCCGCTGAGCTGAAG GGCAAGGATGAAGAGCTTCAGAATGTTCGGGAACAGCT

CCAGCAGGCCCAGGAGGAGCGAGATGGCCACGTGAAGACCATCAGCAACCTGAAGCAG GAGGTAAAGGACACAGTAGACGGGCAGCGCATCCTGGAGAA

GAAAGGCAGCGCTGTG CTCAAAGATCTTAAGCGGCAGCTGCACTTGGAGCGGAAACGGGCTGATAAGCTGCAGGAACGGCTGCAGGAGATCCTTACCAA

CAGCAAGAGCCGCACAG - UNI21745 - GCCTCGAGGAGCTGGTTCTGTCTGAGATGAACTCACCAAGCAGGACCCAGACAGGGGACAGCAGTAGTG

TCTCCTCCTTCAGCTACCGGGAGATCTTGAAGGAGAAGGAGAGTTCAGCCATCCCAGCCAGG TCTCTATCCAGCAGTCCTCAGGCCCAGCCCCCTCGGC

CAGCAGAGCTGTCAGATGAGGAAGTGGCTGAGCTGTTTCAGAGGCTGGCCGAGACTCAGCAGGAAAAATGGATGCTAGAGGAGAAG GTGAAACACCTGG

AGGTGAGCAGCGCCTCTATGGCGGAAGATCTCTGCCGGAAAAGCGCCATCATTGAGACCTACGTCATGGACAGCCGGATTG ATGTGTCTGTGGCAGCAG

GCCACACAGACCGAAGTGGGCTGGGCAGTGTCCTGAGAGACCTAGTGAAGCCAGGCGATGAGAACCTTCGAGAAATGAACAAGAAGCTGCAGAACATGTT

GGAGGAGCAACTCACCAAGAACATGCACTTGCACAAG GACATGGAAGTTCTATCCCAGGAAATTGTGCGGCTCAGCAAGGAATGTGTGGGGTCCCCTGA

CCCAGACCTAGAACCTGGAGAAGCCAACTAAAGACCTACAGGATGCAACTATTCCCAATCCTTTCCAGAATGTCACTCACTCCCTTGGGCTGTTGTGGGA

AAATATGGAGGCTGGCACCAAATTTCATAGTTTGGGAGATGGACATTAAAGGGGCTAGAGGCCTATATGTGGCTGGTGTTGGTGACCCTGATGTATGGCA

GAGCCCTTGGGGAGAAGAGACCCTGAGGGAAGGGCAAGGCTTTTCCTTTTTGGCTCTGGTTCCCAGGGTCATCCGCCTTCAACTCTGCATGAGATCTCCC

TCCTAGAGACCAACTCTGTTTCATTTTATTTTATTTTTTAATTTATGTCTGGAAGCCTGGCTAAACTCTGCCTTCGGGACTGGGGGTATTGGGTGGGGGT

GCAGTCCATGTTCAATGTTCCAGCAACGTGTGTATGTGTGTGAGTATGTGTGTAAAGACTATGTGGCCAAAATACCATCTGGCCAGACGGGCCCACCC
Translation
MAQALSEEEFQRMQ TQLLELRTNNYQLSDELRKNGVE ELSSLRQKVAYLDKEFSKAQK ALSKSKKAQ EVEVLLSENEMLQAKLHSQEEDFRLQNST

LMAEFSK - UNI31015 - LCSQLEQLELENRQLKEGVPGAAGAHVDGELLRLQAENTALQKNMAA ALQERYGKEAVRPSAVGEGQGDPPGDVLPTP

LAPMPLAEVELKWEMEREEKKLLWEQLQGLE SSKQAETSRLQEELAK LSEKLKKKQES SFCRLQTEKETLFNDSR RNKIEELQQRKEADLKAQLAR

TQKLQQELEAANQ SLAELRDQRQGERLEHAAALRALQDQ IQTAKTQELNMLREQTSELASELQHRQAEYEELMGQKDDLNSQLQ - UNI35885 - 

ESLRANSRLLEQLQEIGQEKEQLTQDLQEARK SAEKRKVMLDELAMETLQEKSQHKEELGAVRLRHEKELLGVRARYERELRELHEDKKRQEEELRGQI

REEK ARTRELENLQHTVEELQAQVHSMDGAKGWFERRLKEAE - UNI34924 - ESLQQQQQEQEETLKLCREEHAAELK GKDEELQNVREQLQQA

QEERDGHVKTISNLKQ EVKDTVDGQRILEKKGSAV LKDLKRQLHLERKRADKLQERLQEILTNSKSRTG - UNI21745 - GLEELVLSEMNSPSR

TQTGDSSSVSSFSYREILKEKESSAIPAR SLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWMLEEK VKHLEVSSASMAEDLCRKSAIIETYVMD

SRID DVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHK DMEVLSQEIVRLSKECVGSPDPDLEPGEAN
Transcript ENSMUST00000115675
Sequence
GCGCACAAAGCTTGCGGGGGATGGGGGGAGGAACATGGCGCAAGCTCTGTCTGAAGAGGAGTTTCAACGGATGCAG ACTCAGCTCCTGGAGCTCCGGAC

AAATAACTACCAGCTTTCGGATGAACTTCGGAAGAATGGTGTTG AACTTTCCAGTCTTCGACAGAAGGTCGCCTACCTGGATAAGGAGTTCAGTAAAGC

TCAAAAG GCACTAAGCAAGAGCAAGAAAGCTCAG GAAGTGGAGGTACTGCTGAGTGAAAATGAGATGCTGCAGGCAAAGCTGCACAGCCAGGAGGAGG

ACTTCCGTTTGCAGAACAGTACACTTATGGCCGAGTTCAGCAAG - UNI31015 - CTTTGCAGCCAGCTGGAGCAGCTGGAGCTGGAAAACCGACAA

CTCAAGGAAGGCGTTCCTGGAGCAGCTGGAGCACATGTGGACGGGGAGCTGCTGAGGCTGCAGGCAGAGAACACAGCCTTGCAGAAGAACATGGCAG CA

CTGCAGGAACGCTATGGGAAAGAGGCTGTGAGGCCCTCTGCTGTTGGTGAGGGCCAAGGGGATCCCCCAGGAGACGTACTCCCCACTCCCCTGGCTCCCA

TGCCATTGGCAGAAGTGGAGCTGAAATGGGAAATGGAGCGAGAAGAAAAAAAATTGCTCTGGGAGCAGCTACAAGGCTTAGAG AGCTCAAAGCAAGCTG

AAACCTCCAGACTACAGGAGGAACTTGCTAAG CTCTCTGAGAAATTGAAAAAGAAACAAGAAAG TTTTTGCCGTCTGCAGACAGAGAAGGAAACACTG

TTTAATGACAGCAG AAACAAAATTGAAGAATTGCAACAGCGGAAGGAAGCTGATCTGAAAGCCCAGTTGGCTCGCACCCAAAAACTACAGCAGGAACTT

GAGGCTGCCAATCAG AGTTTGGCAGAGCTAAGAGATCAGCGGCAGGGGGAGCGTCTGGAGCATGCAGCAGCGTTGCGGGCCCTACAAGATCAG GTGTC

CAGCCAGAGTGCAGATGCGCAGGAACAAGTGGAAGGGCTCTTGGCTGAGAACAGTGCCTTGAGGACTAGCTTGGCTGCTCTGGAGCAG ATCCAGACAGC

AAAGACACAAGAACTGAATATGCTTCGGGAACAGACCAGTGAATTGGCATCTGAGTTACAGCATCGTCAAGCTGAATATGAAGAGCTTATGGGACAGAAA

GATGACCTCAACTCGCAGCTCCAG - UNI35885 - GAGTCGTTAAGGGCCAATAGCCGGCTGCTGGAACAACTTCAAGAAATAGGGCAGGAGAAGGA

GCAGCTAACCCAGGATCTCCAGGAAGCTCGGAAG AGTGCCGAGAAAAGGAAGGTCATGCTGGATGAACTAGCCATGGAGACGCTGCAGGAGAAGTCCCA

GCACAAAGAAGAACTGGGGGCCGTCCGGTTACGGCACGAGAAGGAGCTGCTGGGCGTGCGAGCCCGATACGAGCGTGAGCTTCGAGAACTGCACGAGGAC

AAGAAGCGGCAGGAGGAGGAGCTCCGGGGGCAGATTCGTGAGGAGAAG GCTCGAACAAGGGAATTAGAAAATCTTCAGCACACAGTGGAAGAACTCCAG

GCTCAGGTACACTCCATGGATGGAGCCAAGGGCTGGTTTGAACGGCGCTTGAAGGAAGCTGAG - UNI34924 - GAATCTTTGCAGCAGCAGCAACA

GGAACAAGAGGAAACCCTCAAGCTGTGCCGGGAGGAGCACGCCGCTGAGCTGAAG GGCAAGGATGAAGAGCTTCAGAATGTTCGGGAACAGCTCCAGCA

GGCCCAGGAGGAGCGAGATGGCCACGTGAAGACCATCAGCAACCTGAAGCAG GAGGTAAAGGACACAGTAGACGGGCAGCGCATCCTGGAGAAGAAAGG

CAGCGCTGTG CTCAAAGATCTTAAGCGGCAGCTGCACTTGGAGCGGAAACGGGCTGATAAGCTGCAGGAACGGCTGCAGGAGATCCTTACCAACAGCAA

GAGCCGCACAG - UNI21745 - GCCTCGAGGAGCTGGTTCTGTCTGAGATGAACTCACCAAGCAGGACCCAGACAGGGGACAGCAGTAGTGTCTCCT

CCTTCAGCTACCGGGAGATCTTGAAGGAGAAGGAGAGTTCAGCCATCCCAGCCAGG TCTCTATCCAGCAGTCCTCAGGCCCAGCCCCCTCGGCCAGCAG

AGCTGTCAGATGAGGAAGTGGCTGAGCTGTTTCAGAGGCTGGCCGAGACTCAGCAGGAAAAATGGATGCTAGAGGAGAAG GTGAAACACCTGGAGGTGA

GCAGCGCCTCTATGGCGGAAGATCTCTGCCGGAAAAGCGCCATCATTGAGACCTACGTCATGGACAGCCGGATTG ATGTGTCTGTGGCAGCAGGCCACA

CAGACCGAAGTGGGCTGGGCAGTGTCCTGAGAGACCTAGTGAAGCCAGGCGATGAGAACCTTCGAGAAATGAACAAGAAGCTGCAGAACATGTTGGAGGA

GCAACTCACCAAGAACATGCACTTGCACAAG GACATGGAAGTTCTATCCCAGGAAATTGTGCGGCTCAGCAAGGAATGTGTGGGGTCCCCTGACCCAGA

CCTAGAACCTGGAGAAGCCAACTAAAGACCTACAGGATGCAACTATTCCCAATCCTTTCCAGAATGTCACTCACTCCCTTGGGCTGTTGTGGGAAAATAT

GGAGGCTGGCACCAAATTTCATAGTTTGGGAGATGGACATTAAAGGGGCTAGAGGCCTATATGTGGCTGGTGTTGGTGACCCTGATGTATGGCAGAGCCC

TTGGGGAGAAGAGACCCTGAGGGAAGGGCAAGGCTTTTCCTTTTTGGCTCTGGTTCCCAGGGTCATCCGCCTTCAACTCTGCATGAGATCTCCCTCCTAG

AGACCAACTCTGTTTCATTTTATTTTATTTTTTAATTTATGTCTGGAAGCCTGGCTAAACTCTGCCTTCGGGACTGGGGGTATTGGGTGGGGGTGCAGTC

CATGTTCAATGTTCCAGCAACGTGTGTATGTGTGTGAGTATGTGTGTAAAGACTATGTGGCCAAAATACCATCTGGCCAGACGGGCCCACCC
Translation
MAQALSEEEFQRMQ TQLLELRTNNYQLSDELRKNGVE ELSSLRQKVAYLDKEFSKAQK ALSKSKKAQ EVEVLLSENEMLQAKLHSQEEDFRLQNST

LMAEFSK - UNI31015 - LCSQLEQLELENRQLKEGVPGAAGAHVDGELLRLQAENTALQKNMAA ALQERYGKEAVRPSAVGEGQGDPPGDVLPTP

LAPMPLAEVELKWEMEREEKKLLWEQLQGLE SSKQAETSRLQEELAK LSEKLKKKQES SFCRLQTEKETLFNDSR RNKIEELQQRKEADLKAQLAR

TQKLQQELEAANQ SLAELRDQRQGERLEHAAALRALQDQ VSSQSADAQEQVEGLLAENSALRTSLAALEQ IQTAKTQELNMLREQTSELASELQHRQ

AEYEELMGQKDDLNSQLQ - UNI35885 - ESLRANSRLLEQLQEIGQEKEQLTQDLQEARK SAEKRKVMLDELAMETLQEKSQHKEELGAVRLRHE

KELLGVRARYERELRELHEDKKRQEEELRGQIREEK ARTRELENLQHTVEELQAQVHSMDGAKGWFERRLKEAE - UNI34924 - ESLQQQQQEQE

ETLKLCREEHAAELK GKDEELQNVREQLQQAQEERDGHVKTISNLKQ EVKDTVDGQRILEKKGSAV LKDLKRQLHLERKRADKLQERLQEILTNSKS

RTG - UNI21745 - GLEELVLSEMNSPSRTQTGDSSSVSSFSYREILKEKESSAIPAR SLSSSPQAQPPRPAELSDEEVAELFQRLAETQQEKWML

EEK VKHLEVSSASMAEDLCRKSAIIETYVMDSRID DVSVAAGHTDRSGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHK DMEVLSQEIV

RLSKECVGSPDPDLEPGEAN

For any suggestions or comments, please send an email to unitrap@crg.es