Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031154 (Otud5)
Chromosomal location
Chr X: 7418982 - 7453746 (+)
Description
OTU domain containing 5 Gene [Source:MGI (curated);Acc:Otud5-003]
RefSeq_dna
NM_138604 
RefSeq_peptide
NP_613070.2 
UniGene
Mm.416357 
MGI
MGI:1859615 
Uniprot/SWISSPROT
Q3U2S4 
Uniprot/SPTREMBL
A2AES3 Q3TDY8 A2AES5 A2AES4 A2AES2 
Human Ortholog
ENSG00000068308 (OTUD5)
Omim not available
UniTrap UNI22996
Vector Insertion
Chr X: 7419723 - 7419837
Public Clones not available
Private Clones OST279369 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36394
Vector Insertion
Chr X: 7419837 - 7433429
Public Clones IST14730C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5406
Vector Insertion
Chr X: 7433524 - 7444640
Public Clones CSJ087 (baygenomics) A021B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35466
Vector Insertion
Chr X: 7445198 - 7449121
Public Clones IST14546H7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16436
Vector Insertion
Chr X: 7451080 - 7451358
Public Clones not available
Private Clones OST461337 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115665
Sequence
CATGACTATTCTCCCCAAAAAGAAGCCGCCACCTCCCGACGCCGACCCGGCCAACGAACCGCCGCCGCCCGGGCCGCTGCCCCCGGCGCCTCGGCGCGGT

GCGGGTGTAGGCGTGGGTGGCGGCGGCACGGGTGTGGGCGGAGGAGAGCGCGACCGTGACTCCGGCGTCGTGGGGGCCCGTCCCCGGGCTTCGCCGCCAC

CTCAGGGCCCGCTCCCGGGGCCGCCTGGTGCTCTTCATCGTTGGGCACTGGCCGTGCCGCCTGGCGCAGTCGCGGGCCCTCGGCCACAGCAGGCTTCTCC

ACCTCCTTGTGGGGGCCCCGGTGGCCCCGGCGGCGGTCCTGGTGACGCTCTTG - UNI22996 - TTGGCGGGGCCAGTCCGGAACGTGAAGAGGTCG

GAGCGGGCTACAACAGTGAAGACGAGTATGAAGCTGCCGCAGCGCGAATCGAGGCCATGGATCCCGCCACTGTAGAACAG - UNI22996 - - UNI3

6394 - CAGGAACACTGGTTTGAAAAGGCCTTGCGGGACAAGAAAGGCTTCATCATCAAGCAGATGAAGGAGGACGGTGCCTGTCTATTTCGGGCTGTA

G - UNI5406 - CTGACCAGGTGTATGGAGACCAGGACATGCATGAGGTTGTTCGAAAGCATTGCATGGACTATCTG ATGAAGAACGCTGATTACTT

CTCCAACTATGTCACAGAAGACTTCACCACCTATATCAACCGGAAGCGGAAAAACAACTGCCATGGCAACCACATTGAAATGCAGGCTATGGCAGAGATG

TACAACCGTCCTGTGGAGGTGTATCAATATAGCACAG AACCTATCAACACATTCCATGGGATCCATCAAAATGAAGATGAACCCATCCGTGTCAGCTAC

CACCGGAATATCCACTATAATTCAGTGGTGAATCCTAACAAGGCCACTATTGGTGTGGGGCTGGGCCTACCGTCATTTAAGCCAGGG - UNI35466 -

 TTTGCAGAGCAGTCCCTGATGAAGAATGCCATAAAGACATCAGAAGAGTCATGGATTGAACAGCAAATGCTGGAAGACAAGAAACGAGCTACAGACTGG

GAGGCCACAAATGAGGCCATAGAGGAGCAGGTGGCTCGAGAATCTTACCTTCAGTGGCTGAGGGATCAAGAGAAACAGGCCCGCCAG CCCCGGAAAGCC

AGTGCCACATGCAGTTCAGCCACAGCAGCAGCCTCCAGTGGCCTGGAGGAATGGACTAGTCGGTCCCCACGGCAACGAAGTTCAGCCTCGTCACCTGAGC

ACCCTGAACTGCATGCCGAGCTAGGCATTAAGCCCCCTTCCCCAGGCACTGTGTTAGCTCTTGCCAAACCTCCTTCACCCTGTGCACCAG GTACAAGCA

GTCAGTTCTCAGCAGGGGGTGATCGGGCCACCTCTCCTCTTGTGTCCCTCTACCCTGCTCTGGAGTGCCGGGCCCTCATCCAGCAGATGTCCCCCTCTGC

CTTTG - UNI16436 - GTCTGAATGATTGGGACGATGATGAGATCCTAGCATCGGTGCTGGCAGTGTCCCAACAGGAATACCTAGACAGTATGAAGA

AAAACAAAGTGCACAGAGAGCCACCCCCAGACAAGAGTTGATGGACACCCAGGGACTGGACATCATTCCCGATCCCCCACTCCTGCCCTTTGATGCCACC

CAAACTTCTTTGGCTTTCTTCCCTCTTGGCTTCCTTCTTTTGTTTCCTCTTTTCCTTTTTTTTTTCCACTTCCCTCTGGCCGGCCCACCCATGCGCTCCA

TCCATCTCATCCCTGCCACCACCATTGGTCTCTGCCAGCTGAAGTGCCCTATTGCCCCCGCACAGCACCATCTCAGCATTCCACAGGGGACTCTGGAAAG

GGTGCGGAAGGTAGGCAAGAGGCCCACAGAGACAGACCATCTGGCAGCCAGGCAGCCCCAGAAGAGAGACATTCAGACAAAGGAAGTCTTCTGCTCACCC

TTCCTTAAAGATCAGATAAACTTGTCATCCCTTCCCAGCAATGATGACAGGAAAATGGAAGTGGCAAGTTTTCCTTCTAGTATCCGAAGAATCTGAGCCT

TCAATGTTAAAATTTTTCTTAATTAAAATGTGCTTTATTTCACAAAATCAACAAATCAAAAAGAATATTCATGGCAACGTTGGTCCTTTGAGGGTGGCAT

CTCTGGTTTGGAGCTAGGCAGGCTGGCCATGGGACAGAAAGGGCAGAAAAAAGATGGATTTCTGCTGTCTTTTGGCCCCTAGTTCCTTGGAAGGGCAAAG

GCTATGAGGTAGAGGGAGGTGACAGGCATTGCAGGTGGCAGACTGACTTTGGACAGTGAGACCCTGACCTTGCTGCATTGCTTTGCCTTCACCACCGCTA

GTCTGTTTGGAAGGCTTGAGGTGGGGTGTCTTGGGAAATTAGGGCCACTACCCAAGATTTGAATTTAGGGAGTGGGAGCAGCCTCAGCAGATGGGGCACC

CGTGCACTGCAGGTGTTGACAAGATCCACCATCTGTAATGTCCTTGGCACAATAAAACCAAATGTCAGTTTCCCTGAGCAACTCTATTCTGTGTGGGACA

CGGGTGGATGGGCCTCTGGGAAGCACAGGATTTGCTTTGACCAGAGGTCTGCTTGTTCTCCAGTAGGTGCTCTCTGTAAGCTGGGGTTCATATTTGATCT

TCTGTTTATTAAATTAACTTCTTGTCTTGAGACTGATGGCAGAGAATCTCTAGAGCCCAGGTGGGTTAAGACTAACCTAACCCACATAACCAAGATTGTT

TCTTAAAAGAACAAAACCAACAACAACTCTACAACTGGTCGTGGTCATGCCTTTGATCCCAGCACTGAGGAGGGCAGAGGCAGAGGTGGATCTTTTGAGT

TGCAGGCCAGCTGGGCTATACAGCAAGACGCTTTTATTAAAAATCATAAACTTCAGAACCAAATCGACTGAAACTGAAGTCCCTACTCCCACCTACCATA

TTTGCATTAGGGAGCCTAGGGCTAATTTAAAGGACTGTATGAGCCAGAGGCCAAGACTGGTGTCTGAATTTCTACTCTCAACCTTAATGCTCATTCATTC

TTGTGATAATCTGATGAAATAAGCAATCACTAATGAGTTCAGTGACCAGAGGTGGCCCTTGCCCAACTGGGTTTTAAACGTTGGAGGATGAAATGGCTAA

ATCCTTTTTTTGTTGTTTGTTCCTCAGGTCTGTTGACACCTCTGTCCATACCCCTGCTAGGGTTTGTAAAGCCCAGCTAGAGAAGGCTGGCTGGCCCTCA

GGTTTCCTCAGAGCAGTCTTCTCCCACTCCCCAATGCCTCAGTGAGGTCCTTTCAGAAGAAGGCTGTGTAGGGTGGCCCTACGGTGAGGGTATGGCTTGC

CCAGTGGGTGGCTACAGGATATCTGAAATACGTGGTCAAGCATGAGCACGCCAAGAGGGTTGATTCATTTCAAATCTACCTGCCTTGTCTCACTGTGTGG

CTTTGGGCTCTCTTTGACTTTAAAGTGTCCCATCTGCAACTACAGGGGTCATTAATGTCTGCTACCTCATGCTCTCTGATTTGTGAGTATTGACAGAGAA

TGTGTATGGTCAATAATGTACTACTGGGAACAGTACCTGGTACACTCTTAGAGCACAAATGTTGGGGTTCTTACCAGACTTTAGGGGTGGGGGTATTACC

GTATTTTGTAAGTTTGTACCATTTGGCCTCAGCCTGACTCTTGCTACTCTTGGCTTTTACTTGCAATTTGCCCTAACCCTATCTTCAGCAAGACAAAGGG

ATCACCTGAAAAAACCCTGTGTGATCCCATTGGCACTCTCCCTTCTGTCTACGACTATTCCGAAGAACTGTACTATAAATAAACTTCTGGGCTGGGGCTG

TGATGCT
Translation
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGARPRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASP

PPCGGPGGPGGGPGDALV - UNI22996 - VGGASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQ - UNI22996 - - UNI36394 - QEH

WFEKALRDKKGFIIKQMKEDGACLFRAVA - UNI5406 - ADQVYGDQDMHEVVRKHCMDYL MKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQ

AMAEMYNRPVEVYQYSTE EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPG - UNI35466 - FAEQSLMKNAIKTSEES

WIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQ PRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGT

VLALAKPPSPCAPG GTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFG - UNI16436 - GLNDWDDDEILASVLAVSQQEYLDSMKKNKVH

REPPPDKS
Transcript ENSMUST00000115666
Sequence
AGCAGAGAGCTCGGCCGGCCTTGGAGGGAGACAAGGCTGCGACCAATCCGTCTCCGTACCGTCCCACTGGACTTCACATCCGGGATCTCCTCCTGGGCGT

GACCCGCGTCCCGTCTGCGGTCCTCGAACCGGTGTCCTGATCTCTTTATCCAGGCCTTGCTGTTCCCGTCGTGCCTCGCGCACGACCGTAGCCCCCTCAT

CCGGGTTCTCTCCCGGCGTTCTCCGCGTTTGCTTTGCTGTGGGGTACTTGGCGGTGCCGCCATGACTATTCTCCCCAAAAAGAAGCCGCCACCTCCCGAC

GCCGACCCGGCCAACGAACCGCCGCCGCCCGGGCCGCTGCCCCCGGCGCCTCGGCGCGGTGCGGGTGTAGGCGTGGGTGGCGGCGGCACGGGTGTGGGCG

GAGGAGAGCGCGACCGTGACTCCGGCGTCGTGGGGGCCCGTCCCCGGGCTTCGCCGCCACCTCAGGGCCCGCTCCCGGGGCCGCCTGGTGCTCTTCATCG

TTGGGCACTGGCCGTGCCGCCTGGCGCAGTCGCGGGCCCTCGGCCACAGCAGGCTTCTCCACCTCCTTGTGGGGGCCCCGGTGGCCCCGGCGGCGGTCCT

GGTGACGCTCTTGGTGCGACAACTGCGGGGGTGGGCGCGGCAGGGGTGGTGGTGGGCGTGGGTGGTACCGTGGGCGTGGGCGGCTGCTGCTCGGGGCCCG

GGCACAGCAAGCGGCGGCGTCAAGCTCCCGGCGTTGGCGCAGTTGGCGGGGCCAGTCCGGAACGTGAAGAGGTCGGAGCGGGCTACAACAGTGAAGACGA

GTATGAAGCTGCCGCAGCGCGAATCGAGGCCATGGATCCCGCCACTGTAGAACAG - UNI22996 - - UNI36394 - CAGGAACACTGGTTTGAA

AAGGCCTTGCGGGACAAGAAAGGCTTCATCATCAAGCAGATGAAGGAGGACGGTGCCTGTCTATTTCGGGCTGTAG - UNI5406 - CTGACCAGGTG

TATGGAGACCAGGACATGCATGAGGTTGTTCGAAAGCATTGCATGGACTATCTG ATGAAGAACGCTGATTACTTCTCCAACTATGTCACAGAAGACTTC

ACCACCTATATCAACCGGAAGCGGAAAAACAACTGCCATGGCAACCACATTGAAATGCAGGCTATGGCAGAGATGTACAACCGTCCTGTGGAGGTGTATC

AATATAGCACAG AACCTATCAACACATTCCATGGGATCCATCAAAATGAAGATGAACCCATCCGTGTCAGCTACCACCGGAATATCCACTATAATTCAG

TGGTGAATCCTAACAAGGCCACTATTGGTGTGGGGCTGGGCCTACCGTCATTTAAGCCAGGG - UNI35466 - TTTGCAGAGCAGTCCCTGATGAAG

AATGCCATAAAGACATCAGAAGAGTCATGGATTGAACAGCAAATGCTGGAAGACAAGAAACGAGCTACAGACTGGGAGGCCACAAATGAGGCCATAGAGG

AGCAGGTGGCTCGAGAATCTTACCTTCAGTGGCTGAGGGATCAAGAGAAACAGGCCCGCCAGGTCCGGGGACCCAGCCAG CCCCGGAAAGCCAGTGCCA

CATGCAGTTCAGCCACAGCAGCAGCCTCCAGTGGCCTGGAGGAATGGACTAGTCGGTCCCCACGGCAACGAAGTTCAGCCTCGTCACCTGAGCACCCTGA

ACTGCATGCCGAGCTAGGCATTAAGCCCCCTTCCCCAGGCACTGTGTTAGCTCTTGCCAAACCTCCTTCACCCTGTGCACCAG GTACAAGCAGTCAGTT

CTCAGCAGGGGGTGATCGGGCCACCTCTCCTCTTGTGTCCCTCTACCCTGCTCTGGAGTGCCGGGCCCTCATCCAGCAGATGTCCCCCTCTGCCTTTG -

 UNI16436 - CAGGTCTGAATGATTGGGACGATGATGAGATCCTAGCATCGGTGCTGGCAGTGTCCCAACAGGAATACCTAGACAGTATGAAGAAAAA

CAAAGTGCACAGAGAGCCACCCCCAGACAAGAGTTGATGGACACCCAGGGACTGGACATCATTCCCGATCCCCCACTCCTGCCCTTTGATGCCACCCAAA

CTTCTTTGGCTTTCTTCCCTCTTGGCTTCCTTCTTTTGTTTCCTCTTTTCCTTTTTTTTTTCCACTTCCCTCTGGCCGGCCCACCCATGCGCTCCATCCA

TCTCATCCCTGCCACCACCATTGGTCTCTGCCAGCTGAAGTGCCCTATTGCCCCCGCACAGCACCATCTCAGCATTCCACAGGGGACTCTGGAAAGGGTG

CGGAAGGTAGGCAAGAGGCCCACAGAGACAGACCATCTGGCAGCCAGGCAGCCCCAGAAGAGAGACATTCAGACAAAGGAAGTCTTCTGCTCACCCTTCC

TTAAAGATCAGATAAACTTGTCATCCCTTCCCAGCAATGATGACAGGAAAATGGAAGTGGCAAGTTTTCCTTCTAGTATCCGAAGAATCTGAGCCTTCAA

TGTTAAAATTTTTCTTAATTAAAATGTGCTTTATTTCACAAAA
Translation
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGARPRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASP

PPCGGPGGPGGGPGDALGATTAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQ -

 UNI22996 - - UNI36394 - QEHWFEKALRDKKGFIIKQMKEDGACLFRAVA - UNI5406 - ADQVYGDQDMHEVVRKHCMDYL MKNADYF

SNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTE EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPG - 

UNI35466 - FAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQ PRKASATCSSATAAASSGLE

EWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALAKPPSPCAPG GTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFA - UNI16436 

- AGLNDWDDDEILASVLAVSQQEYLDSMKKNKVHREPPPDKS
Transcript ENSMUST00000033494
Sequence
ATGACTATTCTCCCCAAAAAGAAGCCGCCACCTCCCGACGCCGACCCGGCCAACGAACCGCCGCCGCCCGGGCCGCTGCCCCCGGCGCCTCGGCGCGGTG

CGGGTGTAGGCGTGGGTGGCGGCGGCACGGGTGTGGGCGGAGGAGAGCGCGACCGTGACTCCGGCGTCGTGGGGGCCCGTCCCCGGGCTTCGCCGCCACC

TCAGGGCCCGCTCCCGGGGCCGCCTGGTGCTCTTCATCGTTGGGCACTGGCCGTGCCGCCTGGCGCAGTCGCGGGCCCTCGGCCACAGCAGGCTTCTCCA

CCTCCTTGTGGGGGCCCCGGTGGCCCCGGCGGCGGTCCTGGTGACGCTCTTGGTGCGACAACTGCGGGGGTGGGCGCGGCAGGGGTGGTGGTGGGCGTGG

GTGGTACCGTGGGCGTGGGCGGCTGCTGCTCGGGGCCCGGGCACAGCAAGCGGCGGCGTCAAGCTCCCGGCGTTGGCGCAGTTGGCGGGGCCAGTCCGGA

ACGTGAAGAGGTCGGAGCGGGCTACAACAGTGAAGACGAGTATGAAGCTGCCGCAGCGCGAATCGAGGCCATGGATCCCGCCACTGTAGAACAG - UNI

22996 - - UNI36394 - CAGGAACACTGGTTTGAAAAGGCCTTGCGGGACAAGAAAGGCTTCATCATCAAGCAGATGAAGGAGGACGGTGCCTGTC

TATTTCGGGCTGTAG - UNI5406 - CTGACCAGGTGTATGGAGACCAGGACATGCATGAGGTTGTTCGAAAGCATTGCATGGACTATCTG ATGAAG

AACGCTGATTACTTCTCCAACTATGTCACAGAAGACTTCACCACCTATATCAACCGGAAGCGGAAAAACAACTGCCATGGCAACCACATTGAAATGCAGG

CTATGGCAGAGATGTACAACCGTCCTGTGGAGGTGTATCAATATAGCACAG AACCTATCAACACATTCCATGGGATCCATCAAAATGAAGATGAACCCA

TCCGTGTCAGCTACCACCGGAATATCCACTATAATTCAGTGGTGAATCCTAACAAGGCCACTATTGGTGTGGGGCTGGGCCTACCGTCATTTAAGCCAGG

G - UNI35466 - TTTGCAGAGCAGTCCCTGATGAAGAATGCCATAAAGACATCAGAAGAGTCATGGATTGAACAGCAAATGCTGGAAGACAAGAAAC

GAGCTACAGACTGGGAGGCCACAAATGAGGCCATAGAGGAGCAGGTGGCTCGAGAATCTTACCTTCAGTGGCTGAGGGATCAAGAGAAACAGGCCCGCCA

GGTCCGGGGACCCAGCCAG CCCCGGAAAGCCAGTGCCACATGCAGTTCAGCCACAGCAGCAGCCTCCAGTGGCCTGGAGGAATGGACTAGTCGGTCCCC

ACGGCAACGAAGTTCAGCCTCGTCACCTGAGCACCCTGAACTGCATGCCGAGCTAGGCATTAAGCCCCCTTCCCCAGGCACTGTGTTAGCTCTTGCCAAA

CCTCCTTCACCCTGTGCACCAG GTACAAGCAGTCAGTTCTCAGCAGGGGGTGATCGGGCCACCTCTCCTCTTGTGTCCCTCTACCCTGCTCTGGAGTGC

CGGGCCCTCATCCAGCAGATGTCCCCCTCTGCCTTTG - UNI16436 - GTCTGAATGATTGGGACGATGATGAGATCCTAGCATCGGTGCTGGCAGT

GTCCCAACAGGAATACCTAGACAGTATGAAGAAAAACAAAGTGCACAGAGAGCCACCCCCAGACAAGAGTTGATGGACACCCAGGGACTGGACATCATTC

CCGATCCCCCACTCCTGCCCTTTGATGCCACCCAAACTTCTTTGGCTTTCTTCCCTCTTGGCTTCCTTCTTTTGTTTCCTCTTTTCCTTTTTTTTTTCCA

CTTCCCTCTGGCCGGCCCACCCATGCGCTCCATCCATCTCATCCCTGCCACCACCATTGGTCTCTGCCAGCTGAAGTGCCCTATTGCCCCCGCACAGCAC

CATCTCAGCATTCCACAGGGGACTCTGGAAAGGGTGCGGAAGGTAGGCAAGAGGCCCACAGAGACAGACCATCTGGCAGCCAGGCAGCCCCAGAAGAGAG

ACATTCAGACAAAGGAAGTCTTCTGCTCACCCTTCCTTAAAGATCAGATAAACTTGTCATCCCTTCCCAGCAATGATGACAGGAAAATGGAAGTGGCAAG

TTTTCCTTCTAGTATCCGAAGAATCTGAGCCTTCAATGTTAAAATTTTTCTTAATTAAAATGTGCTTTATTTC
Translation
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGARPRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASP

PPCGGPGGPGGGPGDALGATTAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQ -

 UNI22996 - - UNI36394 - QEHWFEKALRDKKGFIIKQMKEDGACLFRAVA - UNI5406 - ADQVYGDQDMHEVVRKHCMDYL MKNADYF

SNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTE EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPG - 

UNI35466 - FAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQ PRKASATCSSATAAASSGLE

EWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALAKPPSPCAPG GTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFG - UNI16436 

- GLNDWDDDEILASVLAVSQQEYLDSMKKNKVHREPPPDKS
Transcript ENSMUST00000115667
Sequence
ATGACTATTCTCCCCAAAAAGAAGCCGCCACCTCCCGACGCCGACCCGGCCAACGAACCGCCGCCGCCCGGGCCGCTGCCCCCGGCGCCTCGGCGCGGTG

CGGGTGTAGGCGTGGGTGGCGGCGGCACGGGTGTGGGCGGAGGAGAGCGCGACCGTGACTCCGGCGTCGTGGGGGCCCGTCCCCGGGCTTCGCCGCCACC

TCAGGGCCCGCTCCCGGGGCCGCCTGGTGCTCTTCATCGTTGGGCACTGGCCGTGCCGCCTGGCGCAGTCGCGGGCCCTCGGCCACAGCAGGCTTCTCCA

CCTCCTTGTGGGGGCCCCGGTGGCCCCGGCGGCGGTCCTGGTGACGCTCTTGGTGCGACAACTGCGGGGGTGGGCGCGGCAGGGGTGGTGGTGGGCGTGG

GTGGTACCGTGGGCGTGGGCGGCTGCTGCTCGGGGCCCGGGCACAGCAAGCGGCGGCGTCAAGCTCCCGGCGTTGGCGCAGTTGGCGGGGCCAGTCCGGA

ACGTGAAGAGGTCGGAGCGGGCTACAACAGTGAAGACGAGTATGAAGCTGCCGCAGCGCGAATCGAGGCCATGGATCCCGCCACTGTAGAACAG - UNI

22996 - - UNI36394 - CAGGAACACTGGTTTGAAAAGGCCTTGCGGGACAAGAAAGGCTTCATCATCAAGCAGATGAAGGAGGACGGTGCCTGTC

TATTTCGGGCTGTAG - UNI5406 - CTGACCAGGTGTATGGAGACCAGGACATGCATGAGGTTGTTCGAAAGCATTGCATGGACTATCTG ATGAAG

AACGCTGATTACTTCTCCAACTATGTCACAGAAGACTTCACCACCTATATCAACCGGAAGCGGAAAAACAACTGCCATGGCAACCACATTGAAATGCAGG

CTATGGCAGAGATGTACAACCGTCCTGTGGAGGTGTATCAATATAGCACAGGTACTTCTGTAGTGG AACCTATCAACACATTCCATGGGATCCATCAAA

ATGAAGATGAACCCATCCGTGTCAGCTACCACCGGAATATCCACTATAATTCAGTGGTGAATCCTAACAAGGCCACTATTGGTGTGGGGCTGGGCCTACC

GTCATTTAAGCCAGGG - UNI35466 - TTTGCAGAGCAGTCCCTGATGAAGAATGCCATAAAGACATCAGAAGAGTCATGGATTGAACAGCAAATGC

TGGAAGACAAGAAACGAGCTACAGACTGGGAGGCCACAAATGAGGCCATAGAGGAGCAGGTGGCTCGAGAATCTTACCTTCAGTGGCTGAGGGATCAAGA

GAAACAGGCCCGCCAGGTCCGGGGACCCAGCCAG CCCCGGAAAGCCAGTGCCACATGCAGTTCAGCCACAGCAGCAGCCTCCAGTGGCCTGGAGGAATG

GACTAGTCGGTCCCCACGGCAACGAAGTTCAGCCTCGTCACCTGAGCACCCTGAACTGCATGCCGAGCTAGGCATTAAGCCCCCTTCCCCAGGCACTGTG

TTAGCTCTTGCCAAACCTCCTTCACCCTGTGCACCAG GTACAAGCAGTCAGTTCTCAGCAGGGGGTGATCGGGCCACCTCTCCTCTTGTGTCCCTCTAC

CCTGCTCTGGAGTGCCGGGCCCTCATCCAGCAGATGTCCCCCTCTGCCTTTG - UNI16436 - GTCTGAATGATTGGGACGATGATGAGATCCTAGC

ATCGGTGCTGGCAGTGTCCCAACAGGAATACCTAGACAGTATGAAGAAAAACAAAGTGCACAGAGAGCCACCCCCAGACAAGAGTTGATGGACACCCAGG

GACTGGACATCATTCCCGATCCCCCACTCCTGCCCTTTGATGCCACCCAAACTTCTTTGGCTTTCTTCCCTCTTGGCTTCCTTCTTTTGTTTCCTCTTTT

CCTTTTTTTTTTCCACTTCCCTCTGGCCGGCCCACCCATGCGCTCCATCCATCTCATCCCTGCCACCACCATTGGTCTCTGCCAGCTGAAGTGCCCTATT

GCCCCCGCACAGCACCATCTCAGCATTCCACAGGGGACTCTGGAAAGGGTGCGGAAGGTAGGCAAGAGGCCCACAGAGACAGACCATCTGGCAGCCAGGC

AGCCCCAGAAGAGAGACATTCAGACAAAGGAAGTCTTCTGCTCACCCTTCCTTAAAGATCAGATAAACTTGTCATCCCTTCCCAGCAATGATGACAGGAA

AATGGAAGTGGCAAGTTTTCCTTCTAGTATCCGAAGAATCTGAGCCTTCAATGTTAAAATTTTTCTTAATTAAAATGTGCTTTATTTC
Translation
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGARPRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASP

PPCGGPGGPGGGPGDALGATTAGVGAAGVVVGVGGTVGVGGCCSGPGHSKRRRQAPGVGAVGGASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQ -

 UNI22996 - - UNI36394 - QEHWFEKALRDKKGFIIKQMKEDGACLFRAVA - UNI5406 - ADQVYGDQDMHEVVRKHCMDYL MKNADYF

SNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSVVE EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFK

PG - UNI35466 - FAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQ PRKASATCSSATAAA

SSGLEEWTSRSPRQRSSASSPEHPELHAELGIKPPSPGTVLALAKPPSPCAPG GTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFG - UNI1

6436 - GLNDWDDDEILASVLAVSQQEYLDSMKKNKVHREPPPDKS
Transcript ENSMUST00000115668
Sequence
GTTTGCTTTGCTGTGGGGTACTTGGCGGTGCCGCCATGACTATTCTCCCCAAAAAGAAGCCGCCACCTCCCGACGCCGACCCGGCCAACGAACCGCCGCC

GCCCGGGCCGCTGCCCCCGGCGCCTCGGCGCGGTGCGGGTGTAGGCGTGGGTGGCGGCGGCACGGGTGTGGGCGGAGGAGAGCGCGACCGTGACTCCGGC

GTCGTGGGGGCCCGTCCCCGGGCTTCGCCGCCACCTCAGGGCCCGCTCCCGGGGCCGCCTGGTGCTCTTCATCGTTGGGCACTGGCCGTGCCGCCTGGCG

CAGTCGCGGGCCCTCGGCCACAGCAGGCTTCTCCACCTCCTTGTGGGGGCCCCGGTGGCCCCGGCGGCGGTCCTGGTGACGCTCTTG - UNI22996 -

 TTGGCGGGGCCAGTCCGGAACGTGAAGAGGTCGGAGCGGGCTACAACAGTGAAGACGAGTATGAAGCTGCCGCAGCGCGAATCGAGGCCATGGATCCCG

CCACTGTAGAACAG - UNI22996 - - UNI36394 - CAGGAACACTGGTTTGAAAAGGCCTTGCGGGACAAGAAAGGCTTCATCATCAAGCAGAT

GAAGGAGGACGGTGCCTGTCTATTTCGGGCTGTAG - UNI5406 - CTGACCAGGTGTATGGAGACCAGGACATGCATGAGGTTGTTCGAAAGCATTG

CATGGACTATCTG ATGAAGAACGCTGATTACTTCTCCAACTATGTCACAGAAGACTTCACCACCTATATCAACCGGAAGCGGAAAAACAACTGCCATGG

CAACCACATTGAAATGCAGGCTATGGCAGAGATGTACAACCGTCCTGTGGAGGTGTATCAATATAGCACAG AACCTATCAACACATTCCATGGGATCCA

TCAAAATGAAGATGAACCCATCCGTGTCAGCTACCACCGGAATATCCACTATAATTCAGTGGTGAATCCTAACAAGGCCACTATTGGTGTGGGGCTGGGC

CTACCGTCATTTAAGCCAGGG - UNI35466 - TTTGCAGAGCAGTCCCTGATGAAGAATGCCATAAAGACATCAGAAGAGTCATGGATTGAACAGCA

AATGCTGGAAGACAAGAAACGAGCTACAGACTGGGAGGCCACAAATGAGGCCATAGAGGAGCAGGTGGCTCGAGAATCTTACCTTCAGTGGCTGAGGGAT

CAAGAGAAACAGGCCCGCCAGGTCCGGGGACCCAGCCAG CCCCGGAAAGCCAGTGCCACATGCAGTTCAGCCACAGCAGCAGCCTCCAGTGGCCTGGAG

GAATGGACTAGTCGGTCCCCACGGCAACGAAGTTCAGCCTCGTCACCTGAGCACCCTGAACTGCATGCCGAGCTAGGCATTAAGCCCCCTTCCCCAGGCA

CTGTGTTAGCTCTTGCCAAACCTCCTTCACCCTGTGCACCAG GTACAAGCAGTCAGTTCTCAGCAGGGGGTGATCGGGCCACCTCTCCTCTTGTGTCCC

TCTACCCTGCTCTGGAGTGCCGGGCCCTCATCCAGCAGATGTCCCCCTCTGCCTTTG - UNI16436 - GTCTGAATGATTGGGACGATGATGAGATC

CTAGCATCGGTGCTGGCAGTGTCCCAACAGGAATACCTAGACAGTATGAAGAAAAACAAAGTGCACAGAGAGCCACCCCCAGACAAGAGTTGATGGACAC

CCAGGGACTGGACATCATTCCCGATCCCCCACTCCTGCCCTTTGATGCCACCCAAACTTCTTTGGCTTTCTTCCCTCTTGGCTTCCTTCTTTTGTTTCCT

CTTTTCCTTTTTTTTTTCCACTTCCCTCTGGCCGGCCCACCCATGCGCTCCATCCATCTCATCCCTGCCACCACCATTGGTCTCTGCCAGCTGAAGTGCC

CTATTGCCCCCGCACAGCACCATCTCAGCATTCCACAGGGGACTCTGGAAAGGGTGCGGAAGGTAGGCAAGAGGCCCACAGAGACAGACCATCTGGCAGC

CAGGCAGCCCCAGAAGAGAGACATTCAGACAAAGGAAGTCTTCTGCTCACCCTTCCTTAAAGATCAGATAAACTTGTCATCCCTTCCCAGCAATGATGAC

AGGAAAATGGAAGTGGCAAGTTTTCCTTCTAGTATCCGAAGAATCTGAGCCTTCAATGTTAAAATTTTTCTTAATTAAAATGTGCTTTATTTC
Translation
MTILPKKKPPPPDADPANEPPPPGPLPPAPRRGAGVGVGGGGTGVGGGERDRDSGVVGARPRASPPPQGPLPGPPGALHRWALAVPPGAVAGPRPQQASP

PPCGGPGGPGGGPGDALV - UNI22996 - VGGASPEREEVGAGYNSEDEYEAAAARIEAMDPATVEQ - UNI22996 - - UNI36394 - QEH

WFEKALRDKKGFIIKQMKEDGACLFRAVA - UNI5406 - ADQVYGDQDMHEVVRKHCMDYL MKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQ

AMAEMYNRPVEVYQYSTE EPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPG - UNI35466 - FAEQSLMKNAIKTSEES

WIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQ PRKASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGIK

PPSPGTVLALAKPPSPCAPG GTSSQFSAGGDRATSPLVSLYPALECRALIQQMSPSAFG - UNI16436 - GLNDWDDDEILASVLAVSQQEYLDSM

KKNKVHREPPPDKS

For any suggestions or comments, please send an email to unitrap@crg.es