Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031170 (Slc38a5)
Chromosomal location
Chr X: 7848277 - 7857305 (+)
Description
solute carrier family 38, member 5 Gene [Source:MGI (curated);Acc:Slc38a5-002]
RefSeq_peptide
NP_766067.2 
UniGene
Mm.421102 Mm.6055 
MGI
MGI:2148066 
Uniprot/SWISSPROT
Q3U1J0 
Uniprot/SPTREMBL
A2ALH6 Q6PD94 
Human Ortholog
ENSG00000017483 (SLC38A5)
Omim not available
UniTrap UNI25099
Vector Insertion
Chr X: 7849236 - 7849777
Public Clones not available
Private Clones OST195170 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37439
Vector Insertion
Chr X: 7851003 - 7853245
Public Clones PST22580-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115591
Sequence
CGCTCCTCCAACTAGTTACATTCGCATACCGGTCAGTTCTTTCCCAGCAAGAGGGGCATTTCAGTTTGTTTCAGTCTCTGGTGAAGATATTCAGAACCGT

AGTAAAAGCA GATGGAAATGCAGGAACCAAAGATGAATGGAACCCTCTCTGCGGGTGCTGCTGCGGG CTACAGGCAGGAACGCGAAGGCTTCCTGCCC

ACCACCCGTAACCCTGCTACTGGGAGGAAACCTGTCCAGTTCTTGGAT - UNI25099 - TTCGAGGGGAAGACATCATTCGGAATGTCAGTGTTCAA

CCTCAGCAACGCTATCATGGGGAGTGGCATCCTGGGACTGGCTTATGCCATGGCACACACTGGAGTCATCTTCTTTTT GGCCCTGCTGCTGTGCATTGC

TCTCCTGTCTTCTTACTCCATTCACCTCCTGCTGACCTGTGCCAGTGTTGTAG GCATCCGTGCCTATGAGCAGCTGGGACAGAGGGCATTTGGACCTGC

CGGGAAAGTAGTCGTGGCCATCATCATCTGTCTGCACAACGTTGGGG CTATGTCCAGTTACCTGTTCATCATCAAATCTGAACTCCCCCTTGTTATTGG

CACCTTCCTGCACATGGACCCTGAGGG - UNI37439 - AGACTGGTTCTTGAAGGGGAATCTCCTTATCATCCTGGTCAGCTTGTTAATCATCTTGC

CCCTGGCTCTCATGAAACACCTGG GCTACCTGGGGTACACAAGCAGCCTCTCCCTGACCTGCATGCTGTTTTTTCTCATTTCG GTCATCTATAAGAAG

TTCCAGATTGGCTGTGATGTGAGCCACAATGACACAGTAGTGGAGGCTGAACAAGCTCCTTTGCAGGCGTTTAACAGCAGCTGCGAGGCCGAGCTCTTCA

CCGTTGACTCGCAG ATGTCTTACACAGTGCCTATTATGGCTTTTGCGTTTGTCTGCCACCCTGAGGTGCTGCCCATCTACACAGAACTTTGCCG CCCC

ACCCAGCGCAGGATGCAAGCTGTGGCCAACATGTCCATCGGAGCTATGTTCATCATGTATGGACTCACAGCGACCTTTGGATACCTCACCTTCTACA GC

ACTGTGAAGGCAGAGATGCTGGAAATGTACACCCAGGAGGACATGCTTATCCTTTGTGTGCGTCTGGCCGTACTGCTTGCAGTAACCCTCACTGTGCCTG

TTGTGCTTTTCCCT ATCCGCCGAGCCCTCCAGCAGCTGCTCTTTCCAAGCAAGGCCTTCAGCTGGCTACGCCATGTGGCCATTGCCTTGATTCTGCTTA

TTCTGGTCAATATCCTCGTCATCTGTGTGCCAACCATCCGCGATATCTTTGGGTTTATTG GGTCCACTTCAGCCCCTAGCCTCATCTTCATCCTTCCCA

GTGTCTTCTACCTCCGTATTGTACCTACTGAGGTGGAACCTTTGTTTTCCTGGCCCAAGATCCAG GCCCTGTGCTTTGGTGTCCTGGGAGTCCTCTTCA

TGGCCATCAGCCTGGGCTTCATGTTTGCCAACTGGGCCACAGGCCAGAGCCGTATGTCTGGCCACTGAGCTGGCCTGGTTTGCCTCACTCAGCCCCTATG

CTCACGCGTGTATACGAGGGAATCCAAGTCACTTTCCTGAGTCCTTCCTGCCTGGGACATGGAGGTGTCTGGTCTCTAATAACATTGCTGTGGGAAATGG

GGACAGTTGAGGAGGCATAGTAAGTAGTTTATCCCCTTCCCCTTAGAGTTGCCTCACTGCCAACCTCATGAGAGGAGGTATGGGAGGCCAGGTCCTTAGA

AGAGTTCTTAGCCCACATAGTTCTCACTTCCTAGATGAAGCTGTTAGGGTTACCCTGGCGCTAAAAGGGAAGAATAAAGATGCTGAATGAAAAA
Translation
 MEMQEPKMNGTLSAGAAAG GYRQEREGFLPTTRNPATGRKPVQFLD - UNI25099 - FEGKTSFGMSVFNLSNAIMGSGILGLAYAMAHTGVIFF

L LALLLCIALLSSYSIHLLLTCASVVG GIRAYEQLGQRAFGPAGKVVVAIIICLHNVGA AMSSYLFIIKSELPLVIGTFLHMDPEG - UNI37439

 - GDWFLKGNLLIILVSLLIILPLALMKHLG GYLGYTSSLSLTCMLFFLIS VIYKKFQIGCDVSHNDTVVEAEQAPLQAFNSSCEAELFTVDSQ MS

YTVPIMAFAFVCHPEVLPIYTELCR RPTQRRMQAVANMSIGAMFIMYGLTATFGYLTFYS STVKAEMLEMYTQEDMLILCVRLAVLLAVTLTVPVVLF

P IRRALQQLLFPSKAFSWLRHVAIALILLILVNILVICVPTIRDIFGFIG GSTSAPSLIFILPSVFYLRIVPTEVEPLFSWPKIQ ALCFGVLGVLFM

AISLGFMFANWATGQSRMSGH
Transcript ENSMUST00000115590
Sequence
CTCTCTCTCTCTCGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGGCTTGTCAGCTCTCCACTTTCTCCTTTGGCGCTCTTTCC

TCTCTGTTCCTGCTTGTCTCTCTGTCCAGTTGCTCTAATTTACATCTGTTGGTCTCTGCTGGGCTCCTCTGCCCTTCTAACTCTCCTCACTTTCTAGTTC

CTTCGCTCCACTCCTGACCCTCCTACCCCATCTCTTTGCCAACAGGATGGAAATGCAGGAACCAAAGATGAATGGAACCCTCTCTGCGGGTGCTGCTGCG

GG CTACAGGCAGGAACGCGAAGGCTTCCTGCCCACCACCCGTAACCCTGCTACTGGGAGGAAACCTGTCCAGTTCTTGGAT - UNI25099 - TTCG

AGGGGAAGACATCATTCGGAATGTCAGTGTTCAACCTCAGCAACGCTATCATGGGGAGTGGCATCCTGGGACTGGCTTATGCCATGGCACACACTGGAGT

CATCTTCTTTTT GGCCCTGCTGCTGTGCATTGCTCTCCTGTCTTCTTACTCCATTCACCTCCTGCTGACCTGTGCCAGTGTTGTAG GCATCCGTGCCT

ATGAGCAGCTGGGACAGAGGGCATTTGGACCTGCCGGGAAAGTAGTCGTGGCCATCATCATCTGTCTGCACAACGTTGGGG CTATGTCCAGTTACCTGT

TCATCATCAAATCTGAACTCCCCCTTGTTATTGGCACCTTCCTGCACATGGACCCTGAGGG - UNI37439 - AGACTGGTTCTTGAAGGGGAATCTC

CTTATCATCCTGGTCAGCTTGTTAATCATCTTGCCCCTGGCTCTCATGAAACACCTGG GCTACCTGGGGTACACAAGCAGCCTCTCCCTGACCTGCATG

CTGTTTTTTCTCATTTCG GTCATCTATAAGAAGTTCCAGATTGGCTGTGATGTGAGCCACAATGACACAGTAGTGGAGGCTGAACAAGCTCCTTTGCAG

GCGTTTAACAGCAGCTGCGAGGCCGAGCTCTTCACCGTTGACTCGCAG ATGTCTTACACAGTGCCTATTATGGCTTTTGCGTTTGTCTGCCACCCTGAG

GTGCTGCCCATCTACACAGAACTTTGCCG CCCCACCCAGCGCAGGATGCAAGCTGTGGCCAACATGTCCATCGGAGCTATGTTCATCATGTATGGACTC

ACAGCGACCTTTGGATACCTCACCTTCTACA GCACTGTGAAGGCAGAGATGCTGGAAATGTACACCCAGGAGGACATGCTTATCCTTTGTGTGCGTCTG

GCCGTACTGCTTGCAGTAACCCTCACTGTGCCTGTTGTGCTTTTCCCT ATCCGCCGAGCCCTCCAGCAGCTGCTCTTTCCAAGCAAGGCCTTCAGCTGG

CTACGCCATGTGGCCATTGCCTTGATTCTGCTTATTCTGGTCAATATCCTCGTCATCTGTGTGCCAACCATCCGCGATATCTTTGGGTTTATTG GGTCC

ACTTCAGCCCCTAGCCTCATCTTCATCCTTCCCAGTGTCTTCTACCTCCGTATTGTACCTACTGAGGTGGAACCTTTGTTTTCCTGGCCCAAGATCCAG 

GCCCTGTGCTTTGGTGTCCTGGGAGTCCTCTTCATGGCCATCAGCCTGGGCTTCATGTTTGCCAACTGGGCCACAGGCCAGAGCCGTATGTCTGGCCACT

GAGCTGGCCTGGTTTGCCTCACTCAGCCCCTATGCTCACGCGTGTATACGAGGGAATCCAAGTCACTTTCCTGAGTCCTTCCTGCCTGGGACATGGAGGT

GTCTGGTCTCTAATAACATTGCTGTGGGAAATGGGGACAGTTGAGGAGGCATAGTAAGTAGTTTATCCCCTTCCCCTTAGAGTTGCCTCACTGCCAACCT

CATGAGAGGAGGTATGGGAGGCCAGGTCCTTAGAAGAGTTCTTAGCCCACATAGTTCTCACTTCCTAGATGAAGCTGTTAGGGTTACCCTGGCGCTAAAA

GGGAAGAATAAAGATGCTGAATG
Translation
MEMQEPKMNGTLSAGAAAG GYRQEREGFLPTTRNPATGRKPVQFLD - UNI25099 - FEGKTSFGMSVFNLSNAIMGSGILGLAYAMAHTGVIFFL

 LALLLCIALLSSYSIHLLLTCASVVG GIRAYEQLGQRAFGPAGKVVVAIIICLHNVGA AMSSYLFIIKSELPLVIGTFLHMDPEG - UNI37439 

- GDWFLKGNLLIILVSLLIILPLALMKHLG GYLGYTSSLSLTCMLFFLIS VIYKKFQIGCDVSHNDTVVEAEQAPLQAFNSSCEAELFTVDSQ MSY

TVPIMAFAFVCHPEVLPIYTELCR RPTQRRMQAVANMSIGAMFIMYGLTATFGYLTFYS STVKAEMLEMYTQEDMLILCVRLAVLLAVTLTVPVVLFP

 IRRALQQLLFPSKAFSWLRHVAIALILLILVNILVICVPTIRDIFGFIG GSTSAPSLIFILPSVFYLRIVPTEVEPLFSWPKIQ ALCFGVLGVLFMA

ISLGFMFANWATGQSRMSGH
Transcript ENSMUST00000033512
Sequence
GAGATAGGGACTGAAAGAGACAGAAAAGGGCAGACGGCGCGGGAGACAGAGTCTGCCCTGTGGGAGGAAAGTTCTATTTCCCACTTCAAATGGCCATTTC

ATGCGCTGTGGG GATGGAAATGCAGGAACCAAAGATGAATGGAACCCTCTCTGCGGGTGCTGCTGCGGG CTACAGGCAGGAACGCGAAGGCTTCCTGC

CCACCACCCGTAACCCTGCTACTGGGAGGAAACCTGTCCAGTTCTTGGAT - UNI25099 - TTCGAGGGGAAGACATCATTCGGAATGTCAGTGTTC

AACCTCAGCAACGCTATCATGGGGAGTGGCATCCTGGGACTGGCTTATGCCATGGCACACACTGGAGTCATCTTCTTTTT GGCCCTGCTGCTGTGCATT

GCTCTCCTGTCTTCTTACTCCATTCACCTCCTGCTGACCTGTGCCAGTGTTGTAG GCATCCGTGCCTATGAGCAGCTGGGACAGAGGGCATTTGGACCT

GCCGGGAAAGTAGTCGTGGCCATCATCATCTGTCTGCACAACGTTGGGG CTATGTCCAGTTACCTGTTCATCATCAAATCTGAACTCCCCCTTGTTATT

GGCACCTTCCTGCACATGGACCCTGAGGG - UNI37439 - AGACTGGTTCTTGAAGGGGAATCTCCTTATCATCCTGGTCAGCTTGTTAATCATCTT

GCCCCTGGCTCTCATGAAACACCTGG GCTACCTGGGGTACACAAGCAGCCTCTCCCTGACCTGCATGCTGTTTTTTCTCATTTCG GTCATCTATAAGA

AGTTCCAGATTGGCTGTGATGTGAGCCACAATGACACAGTAGTGGAGGCTGAACAAGCTCCTTTGCAGGCGTTTAACAGCAGCTGCGAGGCCGAGCTCTT

CACCGTTGACTCGCAG ATGTCTTACACAGTGCCTATTATGGCTTTTGCGTTTGTCTGCCACCCTGAGGTGCTGCCCATCTACACAGAACTTTGCCG CC

CCACCCAGCGCAGGATGCAAGCTGTGGCCAACATGTCCATCGGAGCTATGTTCATCATGTATGGACTCACAGCGACCTTTGGATACCTCACCTTCTACA 

GCACTGTGAAGGCAGAGATGCTGGAAATGTACACCCAGGAGGACATGCTTATCCTTTGTGTGCGTCTGGCCGTACTGCTTGCAGTAACCCTCACTGTGCC

TGTTGTGCTTTTCCCT ATCCGCCGAGCCCTCCAGCAGCTGCTCTTTCCAAGCAAGGCCTTCAGCTGGCTACGCCATGTGGCCATTGCCTTGATTCTGCT

TATTCTGGTCAATATCCTCGTCATCTGTGTGCCAACCATCCGCGATATCTTTGGGTTTATTG GGTCCACTTCAGCCCCTAGCCTCATCTTCATCCTTCC

CAGTGTCTTCTACCTCCGTATTGTACCTACTGAGGTGGAACCTTTGTTTTCCTGGCCCAAGATCCAG GCCCTGTGCTTTGGTGTCCTGGGAGTCCTCTT

CATGGCCATCAGCCTGGGCTTCATGTTTGCCAACTGGGCCACAGGCCAGAGCCGTATGTCTGGCCACTGAGCTGGCCTGGTTTGCCTCACTCAGCCCCTA

TGCTCACGCGTGTATACGAGGGAATCCAAGTCACTTTCCTGAGTCCTTCCTGCCTGGGACATGGAGGTGTCTGGTCTCTAATAACATTGCTGTGGGAAAT

GGGGACAGTTGAGGAGGCATAGTAAGTAGTTTATCCCCTTCCCCTTAGAGTTGCCTCACTGCCAACCTCATGAGAGGAGGTATGGGAGGCCAGGTCCTTA

GAAGAGTTCTTAGCCCACATAGTTCTCACTTCCTAGATGAAGCTGTTAGGGTTACCCTGGCGCTAAAAGGGAAGAATAAAGATGCTGAATG
Translation
MAISCAVG GMEMQEPKMNGTLSAGAAAG GYRQEREGFLPTTRNPATGRKPVQFLD - UNI25099 - FEGKTSFGMSVFNLSNAIMGSGILGLAYA

MAHTGVIFFL LALLLCIALLSSYSIHLLLTCASVVG GIRAYEQLGQRAFGPAGKVVVAIIICLHNVGA AMSSYLFIIKSELPLVIGTFLHMDPEG -

 UNI37439 - GDWFLKGNLLIILVSLLIILPLALMKHLG GYLGYTSSLSLTCMLFFLIS VIYKKFQIGCDVSHNDTVVEAEQAPLQAFNSSCEAEL

FTVDSQ MSYTVPIMAFAFVCHPEVLPIYTELCR RPTQRRMQAVANMSIGAMFIMYGLTATFGYLTFYS STVKAEMLEMYTQEDMLILCVRLAVLLAV

TLTVPVVLFP IRRALQQLLFPSKAFSWLRHVAIALILLILVNILVICVPTIRDIFGFIG GSTSAPSLIFILPSVFYLRIVPTEVEPLFSWPKIQ ALC

FGVLGVLFMAISLGFMFANWATGQSRMSGH

For any suggestions or comments, please send an email to unitrap@crg.es