Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031171 (Ftsj1)
Chromosomal location
Chr X: 7815794 - 7829532 (-)
Description
FtsJ homolog 1 (E. coli) Gene [Source:MGI (curated);Acc:Ftsj1-001]
RefSeq_dna
NM_133991 
RefSeq_peptide
NP_598752.2 
UniGene
Mm.406225 Mm.327529 
MGI
MGI:1859648 
Uniprot/SPTREMBL
A2ALH2 Q91XA6 A2ALH1 Q8JZY1 Q8CBC7 
Human Ortholog
ENSG00000068438 (FTSJ1)
Omim 309549 - MENTAL RETARDATION, X-LINKED 9  
UniTrap UNI21047
Vector Insertion
Chr X: 7828164 - 7829297
Public Clones not available
Private Clones OST344899 (lexicon) OST188489 (lexicon) OST109186 (lexicon) OST79736 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37024
Vector Insertion
Chr X: 7827765 - 7828005
Public Clones CMHD-GT_522D9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26994
Vector Insertion
Chr X: 7827613 - 7827694
Public Clones not available
Private Clones OST79737 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23770
Vector Insertion
Chr X: 7826184 - 7827521
Public Clones not available
Private Clones OST245533 (lexicon)
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9419
Vector Insertion
Chr X: 7824048 - 7826104
Public Clones RRD143 (baygenomics) IST14270F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31816
Vector Insertion
Chr X: 7822185 - 7822557
Public Clones IST10123D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19062
Vector Insertion
Chr X: 7817957 - 7822185
Public Clones IST10793A11 (tigm) IST12966E11 (tigm) IST11459E4 (tigm) IST10343H1 (tigm)
IST13731G12 (tigm) IST15067H4 (tigm) IST12479E12 (tigm) IST13346G10 (tigm)
IST13901H7 (tigm)
Private Clones OST405859 (lexicon) OST29650 (lexicon) OST19985 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30727
Vector Insertion
Chr X: 7815793 - 7817957
Public Clones IST11103H12 (tigm) IST10051H9 (tigm) IST13992F6 (tigm) IST14383A10 (tigm)
IST11024A7 (tigm) IST11877A10 (tigm) IST11487G10 (tigm) IST13778B8 (tigm)
IST10337E9 (tigm) IST12148E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115594
Sequence
TTACCGCGTGGCGACAACCTCTAGGCGTGTACGACAGGCCTTCGGGTCCACTCCGAACACCAACTGGAGTCTGTAATTTTCAGTTTGCAAACTGTTCTCG

AGGCTGGTGAACAGCCACGCTCTGTATCCAAGAGCTGAG - UNI21047 - GACAGCATCAGCACACACTGTCTGCCAGCAGACTGAGATGGGACGGA

CATCTAAGGATAAACGGGATGTCTACTACCGCCTGGCCAAGGAGAATGGCTGGCGGGCCCGAAGCGCTTTCAAGCTCCTGCAACTGGATGAGGAATTCCA

ACTCTTCAAAG - UNI37024 - GTGTGAAGCGAGCGGTTGACTTGTGTGCAGCCCCAGGCAGCTGGAGCCAGGTGCTGAGCCAGAAGGTTGG - UN

I26994 - GGGCCAGGGTTCTGGTCAGGTGGTGGCCGTGGACTTACAGGCTATGGCTCCACTGCCAGGTGTGATACAGATACAGGGCGACATCACTCAG

 - UNI23770 - CTTTCCACTGCCAAGGAGATCATCCAGCACTTTGAAGGCTGCCCTGCTGACCTAGTAGTGTGTGACGGGGCTCCTGATG - UNI9

419 - TCACTGGTCTCCATGATGTGGATGAGTACATGCAGGCCCAGCTTCTGCTAGCT GCTCTCAACATCGCTACTCATGTCTTGAAGCTAGGGGGCT

GCTTCGTGGCCAAG ATATTCCGAGGCCGGGATGTGACCCTGCTCTACAGCCAACTACGTATCTTCTTCTCCAGTGTGCTCTGCGCTAAGCCCAAGAGCA

GCCGGAACTCTAGCATTG AGGCCTTTGCTGTGTGTCAGGGTTATGACCCTCCTGAGGGCTTCATTCCAGACCTGACCAGACCCCTGCTGAACCACTCAT

ATG ATTTCAACCAGTTGGATGGTCCCACCCGTGTTATTGTGCCCTTTGTGGCCTGTGGGGACCTCAGCGCCTACGATTCGGACCGCACTTACTCTCTGG

AT - UNI31816 - CCCCCCATCGCACCCCCATACCAAGAGGCCTGCAGGTTGAAGAAGAATGGACAGCTGGCCAAGGAACTCCTCCCCCAAGAATGC

TCCATCAACAGTGTGGACAAGTTGCCCCAGCCTCTGGCTATCCATACCCTGCTAGACCCCAAG - UNI31816 - GTGGAAGACAATGAAATTCATTG

TTGACCTTAACACATTAAG - UNI19062 - - UNI30727 - - UNI31816 - AGTTTGCAGGAAAAATCAAACTAATACAGCCCAAAAGCTGC

TGCCTGCCAAGACAACTAGAAGCTGGCTTGATGAGTTTGTTTGCAGATGTCATCTATGGGGACTGAACAGACCGACCTAGAGTGAGAATCTATAACACCT

CCATCATGACAAAGAAATGGTGAAGAAGTCCTCAGAACTGCAGGAAGGATTTGTTGAGACTGTGAGCACATTCCTCTTCTCCAAACCTCTCCTGGAATGT

CCTAGAAGGCCCAGGAATTCCCCCAAAGCACTGGTTCTTCCTATGGTCAAACGTCAGCAACCTCCACCAAACATGATGGAGGAAAGCGTGAATGTTGTCA

CTATGACGGAAGTTCAGCTTTAGTCCCAGTTAACAAATATTGGCAATAAATCAAAACAGGAAAAACCCTA
Translation
 - UNI21047 - MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDEEFQLFKG - UNI37024 - GVKRAVDLCAAPGSWSQVLSQKVG - UNI2

6994 - GGQGSGQVVAVDLQAMAPLPGVIQIQGDITQ - UNI23770 - LSTAKEIIQHFEGCPADLVVCDGAPDV - UNI9419 - VTGLHDVD

EYMQAQLLLA ALNIATHVLKLGGCFVAK IFRGRDVTLLYSQLRIFFSSVLCAKPKSSRNSSIE EAFAVCQGYDPPEGFIPDLTRPLLNHSYD DFNQ

LDGPTRVIVPFVACGDLSAYDSDRTYSLD - UNI31816 - PPIAPPYQEACRLKKNGQLAKELLPQECSINSVDKLPQPLAIHTLLDPK - UNI31

816 - VEDNEIHC - UNI19062 - - UNI30727 - - UNI31816 - 
Transcript ENSMUST00000115595
Sequence
GTCGACACAAGATGACGAGACTAACGTCATACGTTGTGCTCCGGTCTGGATCTCCGTGGAACTGAACTGTTTTACAAAGCAAACTTTACCGCGTGGCGAC

AACCTCTAGGCGTGTACGACAGGCCTTCGGGTCCACTCCGAACACCAACTGGAGTCTGTAATTTTCAGTTTGCAAACTGTTCTCGAGGCTGGTGAACAGC

CACGCTCTGTATCCAAGAGCTGAG - UNI21047 - GACAGCATCAGCACACACTGTCTGCCAGCAGACTGAGATGGGACGGACATCTAAGGATAAAC

GGGATGTCTACTACCGCCTGGCCAAGGAGAATGGCTGGCGGGCCCGAAGCGCTTTCAAGCTCCTGCAACTGGATGAGGAATTCCAACTCTTCAAAG - U

NI37024 - GTGTGAAGCGAGCGGTTGACTTGTGTGCAGCCCCAGGCAGCTGGAGCCAGGTGCTGAGCCAGAAGGTTGG - UNI26994 - GGGCCA

GGGTTCTGGTCAGGTGGTGGCCGTGGACTTACAGGCTATGGCTCCACTGCCAGGTGTGATACAGATACAGGGCGACATCACTCAG - UNI23770 - C

TTTCCACTGCCAAGGAGATCATCCAGCACTTTGAAGGCTGCCCTGCTGACCTAGTAGTGTGTGACGGGGCTCCTGATG - UNI9419 - TCACTGGTC

TCCATGATGTGGATGAGTACATGCAGGCCCAGCTTCTGCTAGCT GCTCTCAACATCGCTACTCATGTCTTGAAGCTAGGGGGCTGCTTCGTGGCCAAG 

ATATTCCGAGGCCGGGATGTGACCCTGCTCTACAGCCAACTACGTATCTTCTTCTCCAGTGTGCTCTGCGCTAAGCCCAAGAGCAGCCGGAACTCTAGCA

TTG AGGCCTTTGCTGTGTGTCAGGGTTATGACCCTCCTGAGGGCTTCATTCCAGACCTGACCAGACCCCTGCTGAACCACTCATATG ATTTCAACCAG

TTGGATGGTCCCACCCGTGTTATTGTGCCCTTTGTGGCCTGTGGGGACCTCAGCGCCTACGATTCGGACCGCACTTACTCTCTGGAT CTAGACGGTGGC

TCTGAGTACAAATATACTCCACCCACACAGCCCCCCATCGCACCCCCATACCAAGAGGCCTGCAGGTTGAAGAAGAATGGACAGCTGGCCAAGGAACTCC

TCCCCCAAGAATGCTCCATCAACAGTGTGGACAAGTTGCCCCAGCCTCTGGCTATCCATACCCTGCTAGACCCCAAG - UNI31816 - GTGGAAGAC

AATGAAATTCATTGTTGACCTTAACACATTAAG - UNI19062 - - UNI30727 - - UNI31816 - AGTTTGCAGGAAAAATCAAACTAATAC

AGCCCAAAAGCTGCTGCCTGCCAAGACAACTAGAAGCTGGCTTGATGAGTTTGTTTGCAGATGTCATCTATGGGGACTGAACAGACCGACCTAGAGTGAG

AATCTATAACACCTCCATCATGACAAAGAAATGGTGAAGAAGTCCTCAGAACTGCAGGAAGGATTTGTTGAGACTGTGAGCACATTCCTCTTCTCCAAAC

CTCTCCTGGAATGTCCTAGAAGGCCCAGGAATTCCCCCAAAGCACTGGTTCTTCCTATGGTCAAACGTCAGCAACCTCCACCAAACATGATGGAGGAAAG

CGTGAATGTTGTCACTATGACGGAAGTTCAGCTTTAGTCCCAGTTAACAAATATTGGCAATAAATCAAAACAGGAAAAACCCTA
Translation
 - UNI21047 - MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDEEFQLFKG - UNI37024 - GVKRAVDLCAAPGSWSQVLSQKVG - UNI2

6994 - GGQGSGQVVAVDLQAMAPLPGVIQIQGDITQ - UNI23770 - LSTAKEIIQHFEGCPADLVVCDGAPDV - UNI9419 - VTGLHDVD

EYMQAQLLLA ALNIATHVLKLGGCFVAK IFRGRDVTLLYSQLRIFFSSVLCAKPKSSRNSSIE EAFAVCQGYDPPEGFIPDLTRPLLNHSYD DFNQ

LDGPTRVIVPFVACGDLSAYDSDRTYSLD LDGGSEYKYTPPTQPPIAPPYQEACRLKKNGQLAKELLPQECSINSVDKLPQPLAIHTLLDPK - UNI3

1816 - VEDNEIHC - UNI19062 - - UNI30727 - - UNI31816 - 
Transcript ENSMUST00000033513
Sequence
GACCGGGATATGTCGACACAAGATGACGAGACTAACGTCATACGTTGTGCTCCGGTCTGGATCTCCGTGGAACTGAACTGTTTTACAAAGCAAACTTTAC

CGCGTGGCGACAACCTCTAGGCGTGTACGACAGGCCTTCGGGTCCACTCCGAACACCAACTGGAGTCTGTAATTTTCAGTTTGCAAACTGTTCTCGAGGC

TGGTGAACAGCCACGCTCTGTATCCAAGAGCTGAG - UNI21047 - GACAGCATCAGCACACACTGTCTGCCAGCAGACTGAGATGGGACGGACATC

TAAGGATAAACGGGATGTCTACTACCGCCTGGCCAAGGAGAATGGCTGGCGGGCCCGAAGCGCTTTCAAGCTCCTGCAACTGGATGAGGAATTCCAACTC

TTCAAAG - UNI37024 - GTGTGAAGCGAGCGGTTGACTTGTGTGCAGCCCCAGGCAGCTGGAGCCAGGTGCTGAGCCAGAAGGTTGG - UNI269

94 - GGGCCAGGGTTCTGGTCAGGTGGTGGCCGTGGACTTACAGGCTATGGCTCCACTGCCAGGTGTGATACAGATACAGGGCGACATCACTCAG - U

NI23770 - CTTTCCACTGCCAAGGAGATCATCCAGCACTTTGAAGGCTGCCCTGCTGACCTAGTAGTGTGTGACGGGGCTCCTGATG - UNI9419 

- TCACTGGTCTCCATGATGTGGATGAGTACATGCAGGCCCAGCTTCTGCTAGCT GCTCTCAACATCGCTACTCATGTCTTGAAGCTAGGGGGCTGCTT

CGTGGCCAAG ATATTCCGAGGCCGGGATGTGACCCTGCTCTACAGCCAACTACGTATCTTCTTCTCCAGTGTGCTCTGCGCTAAGCCCAAGAGCAGCCG

GAACTCTAGCATTG AGGCCTTTGCTGTGTGTCAGGGTTATGACCCTCCTGAGGGCTTCATTCCAGACCTGACCAGACCCCTGCTGAACCACTCATATG 

ATACAGATTTCAACCAGTTGGATGGTCCCACCCGTGTTATTGTGCCCTTTGTGGCCTGTGGGGACCTCAGCGCCTACGATTCGGACCGCACTTACTCTCT

GGAT CTAGACGGTGGCTCTGAGTACAAATATACTCCACCCACACAGCCCCCCATCGCACCCCCATACCAAGAGGCCTGCAGGTTGAAGAAGAATGGACA

GCTGGCCAAGGAACTCCTCCCCCAAGAATGCTCCATCAACAGTGTGGACAAGTTGCCCCAGCCTCTGGCTATCCATACCCTGCTAGACCCCAAG - UNI

31816 - GTGGAAGACAATGAAATTCATTGTTGACCTTAACACATTAAG - UNI19062 - - UNI30727 - - UNI31816 - AGTTTGCAGG

AAAAATCAAACTAATACAGCCCAAAAGCTGCTGCCTGCCAAGACAACTAGAAGCTGGCTTGATGAGTTTGTTTGCAGATGTCATCTATGGGGACTGAACA

GACCGACCTAGAGTGAGAATCTATAACACCTCCATCATGACAAAGAAATGGTGAAGAAGTCCTCAGAACTGCAGGAAGGATTTGTTGAGACTGTGAGCAC

ATTCCTCTTCTCCAAACCTCTCCTGGAATGTCCTAGAAGGCCCAGGAATTCCCCCAAAGCACTGGTTCTTCCTATGGTCAAACGTCAGCAACCTCCACCA

AACATGATGGAGGAAAGCGTGAATGTTGTCACTATGACGGAAGTTCAGCTTTAGTCCCAGTTAACAAATATTGGCAATAAATCAAAACAGGAAAAACCCT

ACATATGCACGTTGCTTACTTTTTTATATGACAGTTCACAGACATCTGAAATACTGCTCATATTTCTCACCACTTTGAATGATAGTTGATTTTATAAATT

AATCCTATAATTAGACATCTCATCTATTACCGCATCCCAATTGGGTGATTGGCTGGGCAGGTATTTGTAAGACATCCTCCCATATAGGCTACACCGCCCT

TAAAACTCAAAATCCTCCTGTGTCAGTTCCCTGAGTGCTGAGATTACAGGCCTGTGCCACCAAACCTAGCTACTGTCTTCCAGTTTTATTCAAATGTAAG

GTGATAACTGTATTTCAGCATAGTCTGCTTTCCTCATCATTCAGACGTGTTTGTGTGCATATGCAGGTGTGCCTTCAAAGACGTCCTGTGATGGGCTGAG

GATGCGGATGCGGTAGGTAGGTCCTTGCCTCGTATGCATAAGGCCCTGGGTTCCAATTTCACTAGCACACACACAAAGCCTGATAGTTGGATGTAGTACT

ACCACCACCTATAGTCCTAGCTACTTGGGTGCCTAAAATGAAAACCCTCAAGCCTAGAACTGCAAGGCCAATGTGGACAGTATAGCTAGGCCCTTTTCAA

AAACAAAACAAAGCAAAACAAAAGGTGAAGCCAAATGTAGTAGTACTATAATCCCAGATTTCCAAAGGATTTCTCAAACAATTTTTGCTCTAGTTTTGCT

TTATTTTGTTGAGAAAGGGTCTCATGTAGCCAAGGCTGGCCTCAAACTCACTGTATACCCAAGAATGACATTGAAATACAGATCCAAGCTGAGCGTGGTG

GCGCACGCCTTTAATCCCAGTACTCGGCAGGCAGATTTCTGAGTTTGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACAGCCAGGGCTACACAGAGA

AACCCTGTCTCAAAAAACAAAAAAACAAAACAAAAAAAAAACAAAAAAAAAAAAACAAAGAAACAGAGATTCTCCCTCCCATCCGTACCTCCCAAGTCCA

CATTAAAGGCATGTTTCGCGATGCCTGATTTTACCAGACCAAAGTTTTTTAGGTTGACAGTCTTTTCTTCACGCTTAGCTAACATGTACAAGTCCTTGAA

TTGTATGCCCAGCACTACCAGTATAAGCGGGTGTGGGAGGGAGACTTGTTTTCTAGTCTCCCTAGAGCCCGACAGGCAGCAGCTGACATGCACGCCCTAA

GCTACAGGGTGCCGTCTTCTGTGGCCTAATCCAATGTCTTTACAAACCCTCGTATTCCTGTGCGCCTGCACTTTGGTCTCTGACCACGCCTCTCTCTGTG

ATGCCCGGAATGTCTGCACCCCACTCTGTCTAGAGGTGTTCACACTACAATGGTTTAATCCAAGATGATGATTTTCATTCCAATCAATGTGACCACAGGA

ATGTCCACAGCCCAGGCTATCTGACCTCAGGAATGCATGTCTGGAGGGTCCACAGGAAGGGCATTCAATCACAGATGCTTCTACGCCCACACCCATTGCC

ACAGCAACTCCGCAGTGCCCGGGAAAGAGCTCCACAAGTGTCCCTGTTCTGGGCTTTGACTCTTAGGAGTTGTATCGGTGGGGCAAGTGATCCAGGCAAA

GGAAGGGGAAACCTTGTGCTTGCCCTATTCCATGAGCAGCACGCAGAGATGAGGGATGGAGCTGGAACAGTCAACCTGAGGACCAGTGGTGCGACATGAG

ATCAGAGAGGGCCTATAGGAGGAGCAAGAAATGCCTGAATGGAACCCAATAGC
Translation
 - UNI21047 - MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDEEFQLFKG - UNI37024 - GVKRAVDLCAAPGSWSQVLSQKVG - UNI2

6994 - GGQGSGQVVAVDLQAMAPLPGVIQIQGDITQ - UNI23770 - LSTAKEIIQHFEGCPADLVVCDGAPDV - UNI9419 - VTGLHDVD

EYMQAQLLLA ALNIATHVLKLGGCFVAK IFRGRDVTLLYSQLRIFFSSVLCAKPKSSRNSSIE EAFAVCQGYDPPEGFIPDLTRPLLNHSYD DTDF

NQLDGPTRVIVPFVACGDLSAYDSDRTYSLD LDGGSEYKYTPPTQPPIAPPYQEACRLKKNGQLAKELLPQECSINSVDKLPQPLAIHTLLDPK - UN

I31816 - VEDNEIHC - UNI19062 - - UNI30727 - - UNI31816 - 

For any suggestions or comments, please send an email to unitrap@crg.es