Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031189 (Aff2)
Chromosomal location
Chr X: 66613506 - 67121212 (+)
Description
AF4/FMR2 family, member 2 Gene [Source:MGI (curated);Acc:Aff2-001]
RefSeq_dna
NM_008032 
RefSeq_peptide
NP_032058.2 
UniGene
Mm.466576 
MGI
MGI:1202294 
Uniprot/SWISSPROT
O55112 
Uniprot/SPTREMBL
B1ATW0 Q684J4 
Human Ortholog
ENSG00000155966 (AFF2)
Omim 309548 - FRAGILE SITE, FOLIC ACID TYPE, RARE, FRA(X)(q28)  
UniTrap UNI34023
Vector Insertion
Chr X: 66798445 - 66947118
Public Clones IST14103F12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033532
Sequence
GTCTCGGCCGCCGCCGCCTGTGCAGCCGCCGCCGCCGCTGCTGCCGCCCCGGCTGCCGCGCCGCGCCACTGCCACTGCCTCGCTCGCCCCCGCCTCTGCC

GTCGCCACCCGCCAGCAGCCTGCCAGGCGGGCGGCCCAGGCGACCCCAGCTCTAAGCGGCCGCCACCGCAGCCCGGACGCGCTGGGCAAGCGGGCAGCCG

CGGAGCGAGTGGACCAGAGCGGGAGGTCAGGCTCTTGCCTGCCCGGTGCCATCGCTTCCGCTGCCGCCACTGCTCCGGAGCGCAGGACTAGGTACCCCGG

GCGCCCGCCGCTGCCGCTGATGCGGCCCCAGCACTTTTAACCGGGTAGGAGGGCCAGAGAGCCGCGCCGCCGACCGCAGCCAGAGAGCCGCGCAGCTCAG

AGCCGCGCCGACACGCAGCGAGCAGGGACAGACGGCCGCCAGCCGCCGCCGCCCCGCCGCTATGGATCTATTCGACTTTTTCAGGGATTGGGACTTGGAG

CAGCAGTG TCACTATGAACAAGACCGTAGTGCACTTAAAAAAAGGGAATGGGAACGAAGGAATCAAGAAGTTCAGCAAGAAGAAGATCTCTTTTCTTCA

GGCTTTGATCTTTTTGGGGAGCCCTACAAGGTAGCTGAATAT ACAAACAAAGGGGATGCCCTTGCCAACCGAGTCCAGAACACTCTTGGAAGTTATGAT

GAAATGAAGGATCTGCTATCTAACCATTCCAGTCAGAATCATCTGGTGGGCATTCCAAAGAATTCTGCACCCCAAACTCCCATCAGCAAAAGTGAAGCAA

GCTTTTATCCAGAACAAAAAAATCGAATGATCCCATCTCACCAGGAGACTACCCACTCCTCAACACCGATGCCTCCACCTTCAGTCGTGATACTGAATTC

CACTCTAATACACAGCAACAGAAAATCAAAATCTGAGTGGCCACGAGATAGTCATAACACTAGCCCTGCACAAGCAAGCCAGACCAGCAGTCAACCAAAC

AAGATGCAGACATCCACACAAGACCCACCTCAAACCAGACTGGAAGACTTCTTTGTCTACCCTGCTGAGCAACCCCAAATTGGTACAGTTGAAAAATCTA

ACCCATCTTCAAAGGAAGAAAATAACCCTAATTCAGGTGGAGAAGATACTTTCAAAGAAATTTTTCAGTCTAATTCACCAGAAGAATCTGAATTTACAGT

GCAAGCACCTGGGTCTCCCCTAGTTGCCTCATCTTTATTAGCTCCCAGCAGTGGCCTTTCAGTTCCAACATTCCCACCAGGGCTTTACTGCAAAACAAGC

ATGGGACAACAAAAACCAACTGCATATGTAAGGCCCATGGATGGGCAGGACCAGGCAACTGACATCTCTCCAACACTGAAGCCTTCCATTGAATTTGAGA

ACAGTTTTGGAAACCTCTCCTTTGGATCACTATTGGATGGGAAACCCAGTGCAGTCAGTTCAAAGACTAAACTGCCAAAGTTCACAATCCTGCAAACAAG

TGAA - UNI34023 - GTAAGCCTTACCAGTGATCCAAGCTGTGTTGAAGAAATCTTGCGG GAATCTCAGCATCTGACTCCAGGATTTACCTTACAA

A AGTGGAGCGACCCAAGCAGCAGAGCTTCCACAAA GATGCTTGAGGATGACTTGAAGCTGAGCAGTGATGAAGATGACCTTGAGCCTGTGAAGACCTT

GACCACACAGTGCACAGCCAACGAGCTTTACCAG GCTGTTGAAAAGGCAAAACCTAAGAATAATCCTGTGAA CCCACTCTTGGCCACACCACAGTCTA

CGCCTGCAACACAAACCAATGTGGGGTCTGGCAGCTCCAGTGAGTCAGAGAGTAGCTCAGAATCGGACTCAGACACTGAAAGCAGCACCACTGACAGCGA

ATCCAATGAGGCTCCTAGAGTGGCTACTCCAGAG CCTGAGCCACCCTCAACCAACAAATGGCAGCTAGACAAATGGCTGAACAAAGTCACGTCCCAGAA

CAAGTCATTTATTTGTGGCCAAAATGAGACACCCACAGAGACCATTTCTCTGCCTCCTCCAATAATACAACCGGTGGAGGTCCAGGTCAAAGTGAAACCA

AACCCTAGCCAGGCTGTGGCTGTACCCAAAGAAAGGCCTCTCCTTAGTCTTATTAGGGAAAAAGCTCGACCAAGGCCCACACAGAAAACTCCAGAAACAA

AGGCCTTGAAGCATAAGCTGTCAACATCAGTTGACACAGTTTCTCAAAGGACAATTGGAAAGAAACAGCCCAAAAAAGTTGAGAAAAACACCAGCTTTGA

GGAGTTTACCTGGCCCAAACCAAATATTACCAACAGCACTCCCAAAGAAAAAGGAAGTGTAGAGCTTCCTGACCCACCACGAAGCCGAAACAAAGCTACT

GCCCACAAACCAGTGCCTAGGAAAGAGCCAAGGCCTCATGTCCCTCTGGCCACTGAGAAGAAGAAGTATAGAGGGCCTGGGAAGATTGTCCCCAAGTCCC

GGGAATTTATTGAAACAGATTCATCTACATCTGACTCCAACACAGACCAGGAAGAGACCCTACAGATCAAAGTACTGCCACCTTGCATTACTTCTAAATC

CAAGGAAACTTCTAATGCCAGCCTGACACTTAGCACCTTGACCAATGGCAACAGCAACAACTTATCCACCAGCAATGAGGAGACAGCTTTTTCCCCGCCT

CCTGCCATGCAAACTGAGCTTTTGTCCCCTCTACGGGATCATGAAAATCCAAAAAACCTCTGGGTGAAGATTGACCTCGACTTACTTTCTAGAGTACCTG

GCCAAAATTCAGTCCCAGTAACACCTGCAAAGACAGACTACAAGGAGACTGCCTCTAAACCCAAGCGTCAAACTGCTGCCACAGCTGTGGAAAAACCAGC

CCCTAAGGGCAAACGTAAGCACAAG CCAGCAGAAACTGCAGAGAAAATCCCTGAGAAGAAGCAGCGCCTGGAGGACAACACTACTATCTGCCTGCTTCC

CCCTTGCATCTCACCAGCCCCGCCCCACAAGCCTCCCAGCACTAGAGA AAATTCATCCAGGAGAGCAAACAGGAAAAAAGAAGAAAAGCTGTTCCCTCC

TGCACTTTCCCCACTGGCAGAGGATCCTCCACGTCGCAGAAATGTCAGTGGCAACAATGGGCATTTCGGTCAGGACAAAAACATTTCCATGGCTGGACAA

ATCACCTCTAGCAAACCTAAAAGAAGTGAAGGCAAATTCTGTGCTACTTTCAAGGGGATATCTATAAAT GAGGGAGATGCTCCAAAAAAGGCTGCCTCT

GCCACCGTTACTGTCGCCAATATGGCTCTTGCCACTGCTACTGCCACTGCCACTGTTCCTGCCATTGTCACTGCCACTGTCACAGCTACTGCCACCACCA

CTGCTACAGCCACTACCACAACCACTACCACTACTATTTCTAGCATCACCCCTACAATCACTTCTGGCCTTATGGATAGCAGTCACCTGGAGATGACATC

CTGGGCAGCCCTGCCCCTTCTGTCCAGCAGTAGTGCCAATGTCCGGAGACCCAAGCTCACATTTGATGACTC TGTTCACAATGCTGATTTTTACATGCA

AGAGGCTAAGAAGCTGAAACACAAAGCTGATGCACTG TTTGAGAAATTTGGCAAAGCTGTGAATTATGCAGATGCAGCCTTGTCCTTCACTGAATGTGG

CAATGCCATGGAACGTGATCCTCTGGAAGCGAAGTCCCCATATACCATGTATTCTGAGACTGTGGAGCTCCTCAG GTATGCAATGAGACTGAAGAACTT

TGCAAGCCCCTTGGCTTCTGATGGGGATAAAAAGCTAGCCGTATTATG CTACCGATGCTTGTCACTTCTCTATTTGAGGATGTTTAAACTGAAGAAGGA

CCATGCTATGAAGTACTCCAGATCACTGATGGAATATTTTAAG CAAAATGCTTCAAAAGTTACTCAGATACCATCTCCTTGGGTAGGCAATGGAAA GA

ATACTCCATCCCCAGTGTCTCTCAACAATGTCTCTCCCATCAACTCAGTGGGGAATTGTAACAATGGCCCTGTCACAATTCCCCAGCGCATCCACCATAT

GGCTGCTAGCCATGTGAATATTACCAGTAATGTGCTTCGGGGCTATGAACACTGGGATATGGCTGACAAACTGACAAGAGACAATAAAG AATTCTTTGG

TGATCTGGATACACTGATGGGGCCTCTGACCCAGCACAGCAGCATGACCAATCTTGTCCGCTATGTTCGCCAGGGACTGTGTTGGCTACGCATCGATGCT

CATTTGTTGTAGTGGGCACTCTGCCATCTCTCGCATCAGCACTCATCCTTTACCAGTGCCTTAATGGTCACTGGTGGAACTCCACTCATTTGGGAAAGTT

CTCTTTCATTATGTTTGTTTTTGTGCATTTTTGATATCTGTGAAAAACTGAAGTCATTGTAAGTGGACACTACAACTTGAGAGAAGTGTATGTTTTATTT

TTTAATATTTGATATGCA
Translation
MDLFDFFRDWDLEQQC CHYEQDRSALKKREWERRNQEVQQEEDLFSSGFDLFGEPYKVAEY TNKGDALANRVQNTLGSYDEMKDLLSNHSSQNHLVGI

PKNSAPQTPISKSEASFYPEQKNRMIPSHQETTHSSTPMPPPSVVILNSTLIHSNRKSKSEWPRDSHNTSPAQASQTSSQPNKMQTSTQDPPQTRLEDFF

VYPAEQPQIGTVEKSNPSSKEENNPNSGGEDTFKEIFQSNSPEESEFTVQAPGSPLVASSLLAPSSGLSVPTFPPGLYCKTSMGQQKPTAYVRPMDGQDQ

ATDISPTLKPSIEFENSFGNLSFGSLLDGKPSAVSSKTKLPKFTILQTSE - UNI34023 - VSLTSDPSCVEEILR ESQHLTPGFTLQK KWSDPS

SRASTK KMLEDDLKLSSDEDDLEPVKTLTTQCTANELYQ AVEKAKPKNNPVN NPLLATPQSTPATQTNVGSGSSSESESSSESDSDTESSTTDSESN

EAPRVATPE PEPPSTNKWQLDKWLNKVTSQNKSFICGQNETPTETISLPPPIIQPVEVQVKVKPNPSQAVAVPKERPLLSLIREKARPRPTQKTPETKA

LKHKLSTSVDTVSQRTIGKKQPKKVEKNTSFEEFTWPKPNITNSTPKEKGSVELPDPPRSRNKATAHKPVPRKEPRPHVPLATEKKKYRGPGKIVPKSRE

FIETDSSTSDSNTDQEETLQIKVLPPCITSKSKETSNASLTLSTLTNGNSNNLSTSNEETAFSPPPAMQTELLSPLRDHENPKNLWVKIDLDLLSRVPGQ

NSVPVTPAKTDYKETASKPKRQTAATAVEKPAPKGKRKHK PAETAEKIPEKKQRLEDNTTICLLPPCISPAPPHKPPSTRE ENSSRRANRKKEEKLFP

PALSPLAEDPPRRRNVSGNNGHFGQDKNISMAGQITSSKPKRSEGKFCATFKGISIN EGDAPKKAASATVTVANMALATATATATVPAIVTATVTATAT

TTATATTTTTTTTISSITPTITSGLMDSSHLEMTSWAALPLLSSSSANVRRPKLTFDDS SVHNADFYMQEAKKLKHKADAL FEKFGKAVNYADAALSF

TECGNAMERDPLEAKSPYTMYSETVELLR RYAMRLKNFASPLASDGDKKLAVLC CYRCLSLLYLRMFKLKKDHAMKYSRSLMEYFK QNASKVTQIPS

PWVGNGK KNTPSPVSLNNVSPINSVGNCNNGPVTIPQRIHHMAASHVNITSNVLRGYEHWDMADKLTRDNKE EFFGDLDTLMGPLTQHSSMTNLVRYV

RQGLCWLRIDAHLL

For any suggestions or comments, please send an email to unitrap@crg.es