Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031196 (F8)
Chromosomal location
Chr X: 72418075 - 72627868 (-)
Description
coagulation factor VIII Gene [Source:MGI (curated);Acc:F8-001]
RefSeq_dna
NM_007977 
RefSeq_peptide
NP_032003.1 
UniGene
Mm.1805 
MGI
MGI:88383 
Uniprot/SWISSPROT
Q06194 
Uniprot/SPTREMBL
B1AW26 Q684Q7 A2AN88 Q8BQ43 
Human Ortholog
ENSG00000185010 (F8)
Omim 134500 - FACTOR VIII DEFICIENCY  306700 - HEMOPHILIA A  
UniTrap UNI35416
Vector Insertion
Chr X: 72457256 - 72497153
Public Clones IST12148B5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15119
Vector Insertion
Chr X: 72418074 - 72455880
Public Clones PST12597-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114085
Sequence
ATGCAACCAGCAGTACTTCACTCTAAGCGACAAAG TGCCATCAGAAGATACTACCTTGGTGCAGTGGAATTGTCCTGGAACTATATTCAGAGTGATCTG

CTCAGTGTGCTGCATACAGACTCAAG ATTTCTTCCTAGAATGTCAACATCTTTTCCATTCAACACCTCCATCATGTATAAAAAGACTGTGTTTGTAGAG

TACAAGGACCAGCTTTTCAACATTGCCAAGCCCAGGCCACCCTGGATGG GTTTGCTAGGTCCTACCATTTGGACTGAGGTTCATGACACAGTGGTCATT

ACACTTAAAAACATGGCTTCTCATCCTGTCAGTCTTCATGCTGTTGGTGTGTCCTACTGGAAAGCTTCTGAGG GAGATGAATATGAAGATCAGACAAGC

CAAATGGAGAAGGAAGATGATAAAGTTTTCCCTGGTGAAAGTCATACTTATGTTTGGCAAGTCCTGAAAGAGAATGGTCCAATGGCCTCTGACCCTCCAT

GTCTCACTTACTCATATATGTCTCATGTGGATCTGGTGAAAGATTTGAATTCAGGCCTCATTGGAGCTCTGCTAGTATGTAAAGAAG GCAGTCTCTCCA

AAGAAAGAACACAGATGTTGTACCAATTTGTACTGCTTTTTGCTGTATTTGATGAAG GGAAGAGCTGGCACTCAGAAACAAACGACTCTTATACACAGT

CTATGGATTCTGCATCTGCTAGAGACTGGCCTAAAATGCACACAGTCAATGGCTATGTAAACAGGTCTCTTCCAG GTCTGATTGGATGCCATAGGAAAT

CAGTCTACTGGCACGTGATTGGAATGGGCACCACTCCTGAAATACACTCAATATTCCTCGAAGGTCACACATTTTTTGTGAGGAACCACCGTCAAGCTTC

ATTGGAGATATCACCAATAACTTTCCTTACTGCTCAAACACTCTTGATAGATCTTGGGCAGTTCCTACTATTTTGTCATATCTCTTCCCATAAACATG A

TGGCATGGAAGCTTATGTCAAAGTAGATAGCTGCCCTGAGGAATCCCAATGGCAAAAGAAAAATAATAATGAGGAAATGGAAGATTATGATGATGATCTT

TATTCAGAAATGGATATGTTCACATTGGATTATGACAGCTCTCCTTTTATCCAAATTCGCTCGGTTGCTAAAAAGTACCCTAAAACTTGGATACATTATA

TTTCTGCTGAGGAGGAAGACTGGGACTA
Translation
MQPAVLHSKRQS SAIRRYYLGAVELSWNYIQSDLLSVLHTDSR RFLPRMSTSFPFNTSIMYKKTVFVEYKDQLFNIAKPRPPWMG GLLGPTIWTEVH

DTVVITLKNMASHPVSLHAVGVSYWKASEG GDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKENGPMASDPPCLTYSYMSHVDLVKDLNSGLIGALLVC

KEG GSLSKERTQMLYQFVLLFAVFDEG GKSWHSETNDSYTQSMDSASARDWPKMHTVNGYVNRSLPG GLIGCHRKSVYWHVIGMGTTPEIHSIFLEG

HTFFVRNHRQASLEISPITFLTAQTLLIDLGQFLLFCHISSHKHD DGMEAYVKVDSCPEESQWQKKNNNEEMEDYDDDLYSEMDMFTLDYDSSPFIQIR

SVAKKYPKTWIHYISAEEEDWD
Transcript ENSMUST00000033539
Sequence
TCTAGAGTTTCTTTGCTACAGGTACCAAGGAACAGTCTTTTAGAATAGGCTAGGAATTTAAATACACCTGAACGCCCCTCCTCAGTATTCTGTTCCTTTT

CTTAAGGATTCAAACTTGTTAGGATGCACCCAGCAGGAAATGGGTTAAGCCTTAGCTCAGCCACTCTTCCTATTCCAGTTTTCCTGTGCCTGCTTCCTAC

TACCCAAAAGGAAGTAATCCTTTCAGATCTGTTTTGTGCTAATGCTACTTTCACTCACAGTAGATAAACTTCCAGAAAATGCTCTGCAAAATATTTAGGA

CTTTTTACTAAATCATTACATTTTCTTTTTGTTCTTAAAAGCTAAAGTTATTTTAGAGAAGAGTTAAATTTTCATTTCTTTAGTTGAACATTTTCTAGTA

ATAAAAGCCATGCAAATAGCACTCTTCGCTTGCTTCTTTCTGAGCCTTTTCAATTTCTGCTCTAGTGCCATCAGAAGATACTACCTTGGTGCAGTGGAAT

TGTCCTGGAACTATATTCAGAGTGATCTGCTCAGTGTGCTGCATACAGACTCAAG ATTTCTTCCTAGAATGTCAACATCTTTTCCATTCAACACCTCCA

TCATGTATAAAAAGACTGTGTTTGTAGAGTACAAGGACCAGCTTTTCAACATTGCCAAGCCCAGGCCACCCTGGATGG GTTTGCTAGGTCCTACCATTT

GGACTGAGGTTCATGACACAGTGGTCATTACACTTAAAAACATGGCTTCTCATCCTGTCAGTCTTCATGCTGTTGGTGTGTCCTACTGGAAAGCTTCTGA

GG GAGATGAATATGAAGATCAGACAAGCCAAATGGAGAAGGAAGATGATAAAGTTTTCCCTGGTGAAAGTCATACTTATGTTTGGCAAGTCCTGAAAGA

GAATGGTCCAATGGCCTCTGACCCTCCATGTCTCACTTACTCATATATGTCTCATGTGGATCTGGTGAAAGATTTGAATTCAGGCCTCATTGGAGCTCTG

CTAGTATGTAAAGAAG GCAGTCTCTCCAAAGAAAGAACACAGATGTTGTACCAATTTGTACTGCTTTTTGCTGTATTTGATGAAG GGAAGAGCTGGCA

CTCAGAAACAAACGACTCTTATACACAGTCTATGGATTCTGCATCTGCTAGAGACTGGCCTAAAATGCACACAGTCAATGGCTATGTAAACAGGTCTCTT

CCAG GTCTGATTGGATGCCATAGGAAATCAGTCTACTGGCACGTGATTGGAATGGGCACCACTCCTGAAATACACTCAATATTCCTCGAAGGTCACACA

TTTTTTGTGAGGAACCACCGTCAAGCTTCATTGGAGATATCACCAATAACTTTCCTTACTGCTCAAACACTCTTGATAGATCTTGGGCAGTTCCTACTAT

TTTGTCATATCTCTTCCCATAAACATG ATGGCATGGAAGCTTATGTCAAAGTAGATAGCTGCCCTGAGGAATCCCAATGGCAAAAGAAAAATAATAATG

AGGAAATGGAAGATTATGATGATGATCTTTATTCAGAAATGGATATGTTCACATTGGATTATGACAGCTCTCCTTTTATCCAAATTCGCTCGGTTGCTAA

AAAGTACCCTAAAACTTGGATACATTATATTTCTGCTGAGGAGGAAGACTGGGACTATGCACCTTCAGTTCCTACCTCGGATAATGG AAGTTATAAAAG

CCAGTATCTGAGCAATGGTCCTCATCGGATTGGTAGGAAATATAAAAAAGTCAGATTTATAGCATACACAGATGAAACCTTTAAGACTCGTGAAACTATT

CAGCATGAATCAGGACTCTTGGGACCTTTACTTTATGGAGAAGTTGGAGACACACTGTTG ATTATTTTTAAGAATCAAGCAAGCCGACCATATAACATT

TACCCTCATGGAATCACTGATGTCAGTCCTCTACATGCAAGGAGATTGCCAAGAG GTATAAAGCACGTGAAGGATTTGCCAATTCATCCAGGAGAGATA

TTCAAGTACAAGTGGACAGTTACAGTAGAAGATGGACCAACTAAATCAGATCCACGGTGCCTGACCCGCTATTATTCAAGTTTCATTAACCCTGAGAGAG

ATCTAGCTTCAGGACTGATTGGCCCTCTTCTCATCTGCTACAAAGAATCTGTAGATCAAAGGGGAAACCAG ATGATGTCAGACAAAAGAAATGTCATCC

TGTTTTCTATATTTGATGAGAACCAAAGCTGGTACATCACAGAGAACATGCAACGCTTCCTCCCCAATGCAGCTAAAACACAGCCCCAGGACCCTGGGTT

CCAGGCCTCCAACATCATGCACA GCATCAATGGCTATGTTTTTGATAGCTTGGAGTTGACAGTTTGTTTGCATGAGGTGGCATACTGGCACATTCTCAG

TGTTGGAGCACAGACAGACTTCTTATCTATCTTCTTCTCTGGATATACTTTCAAACACAAAATGGTCTATGAAGATACACTTACCCTGTTCCCATTCTCA

GGAGAAACTGTCTTTATGTCGATGGAAAACCCAG GTCTATGGGTCTTGGGGTGTCATAATTCAGACTTTCGGAAGAGAGGTATGACAGCATTGCTGAAA

GTTTCTAGTTGTGACAAGAGCACTAGTGATTATTATGAAGAAATATATGAAGATATTCCAACACAGTTGGTGAATGAGAACAATGTCATTGATCCCAGAA

GCTTCTTCCAGAATACAAATCATCCTAATACTAGGAAAAAGAAATTCAAAGATTCCACAATTCCAAAAAATGATATGGAGAAGATTGAGCCTCAGTTTGA

AGAGATAGCAGAGATGCTTAAAGTACAGAGTGTCTCAGTTAGTGACATGTTGATGCTCTTGGGACAGAGTCATCCTACTCCACATGGCTTATTTTTATCA

GATGGCCAAGAAGCCATCTATGAGGCTATTCATGATGATCATTCACCAAATGCAATAGACAGCAATGAAGGCCCATCTAAAGTGACCCAACTCAGGCCAG

AATCCCATCACAGTGAGAAAATAGTATTTACTCCTCAGCCCGGCCTCCAGTTAAGATCCAATAAAAGTTTGGAGACAACTATAGAAGTAAAGTGGAAGAA

ACTTGGTTTGCAAGTTTCTAGTTTGCCAAGTAATCTAATGACTACAACAATTCTGTCAGACAATTTGAAAGCAACTTTTGAAAAGACAGATTCTTCAGGA

TTTCCAGATATGCCAGTTCACTCTAGTAGTAAATTAAGTACTACTGCATTTGGTAAGAAAGCATATTCCCTTGTTGGGTCTCATGTACCTTTAAACGTGA

GTGAAGAAAATAGTGATTCCAACATATTGGATTCAACTTTAATGTATAGTCAAGAAAGTTTACCAAGAGATAATATATTATCAATGGAGAATGATAGATT

ACTCAGAGAGAAGAGGTTTCATGGAATTGCTTTATTGACCAAAGATAATACTTTATTCAAAGACAATGTCTCCTTAATGAAAACAAACAAAACATATAAT

CATTCAACAACTAATGAAAAACTACACACTGAGAGCCCAACATCAATTGAGAATAGTACAACAGACTTGCAAGATGCCATATTAAAGGTCAATAGTGAGA

TTCAAGAAGTAACAGCTTTGATTCATGATGGAACACTTTTAGGCAAAAATTCTACATATTTGAGACTAAACCATATGCTAAATAGAACTACCTCAACAAA

AAATAAAGACATATTTCATAGAAAAGATGAAGATCCTATTCCACAAGATGAAGAGAATACAATCATGCCATTTTCCAAGATGTTGTTCTTGTCAGAATCT

TCAAATTGGTTTAAAAAGACCAATGGAAATAATTCCTTGAACTCTGAGCAAGAACATAGTCCAAAGCAATTAGTATATTTAATGTTTAAAAAATATGTAA

AAAATCAAAGTTTCTTGTCAGAGAAAAATAAAGTCACAGTAGAACAGGATGGATTTACAAAGAACATAGGACTTAAAGACATGGCTTTTCCACATAATAT

GAGCATATTTCTTACCACTTTGTCTAACGTACATGAAAATGGTAGGCACAATCAAGAAAAAAATATTCAGGAAGAGATAGAGAAGGAAGCACTAATTGAA

GAGAAAGTAGTTTTGCCCCAGGTGCACGAAGCAACTGGCTCTAAGAATTTCTTGAAAGACATATTGATACTAGGCACTAGGCAAAATATAAGTTTATATG

AAGTACATGTACCAGTACTTCAAAACATCACATCAATAAACAATTCAACAAATACAGTACAGATTCACATGGAGCATTTCTTTAAAAGAAGGAAGGACAA

GGAAACAAATTCAGAAGGCTTGGTAAATAAAACCAGAGAAATGGTAAAAAACTATCCAAGCCAGAAGAATATTACTACTCAACGTAGTAAACGGGCTTTG

GGACAATTCAGACTGTCAACTCAATGGCTTAAAACCATAAACTGTTCAACACAGTGTATCATTAAACAGATAGACCACAGCAAGGAAATGAAAAAGTTCA

TTACTAAATCTTCCTTATCAGATTCTTCTGTGATTAAAAGCACCACTCAGACAAATAGTTCTGACTCACACATTGTAAAAACATCAGCATTTCCACCAAT

AGATCTCAAAAGGAGTCCATTCCAAAACAAATTTTCTCATGTTCAAGCATCATCCTACATTTATGACTTTAAGACAAAAAGTTCAAGAATTCAAGAAAGC

AATAATTTCTTAAAAGAAACCAAAATAAATAACCCTTCTTTAGCCATTCTACCATGGAATATGTTCATAGATCAAGGAAAATTTACCTCCCCAGGGAAAA

GTAACACAAACTCAGTCACATATAAGAAACGTGAGAACATTATTTTCTTGAAACCAACTTTGCCTGAAGAATCTGGCAAAATTGAATTGCTTCCTCAAGT

TTCCATTCAAGAGGAAGAAATTTTACCTACAGAAACTAGCCATGGATCTCCTGGACACTTGAATCTCATGAAAGAGGTCTTTCTTCAGAAAATACAGGGG

CCTACTAAATGGAATAAAGCAAAGAGGCATGGAGAAAGTATAAAAGGTAAAACAGAGAGCTCTAAAAATACTCGCTCAAAACTGCTAAATCATCATGCTT

GGGATTATCATTATGCTGCACAGATACCAAAAGATATGTGGAAATCCAAAGAGAAGTCACCAGAAATTATATCCATTAAGCAAGAGGACACCATTTTGTC

TCTGAGGCCTCATGGAAACAGTCATTCAATAGGGGCAAATGAGAAACAAAATTGGCCTCAAAGAGAAACCACTTGGGTAAAGCAAGGCCAAACTCAAAGG

ACATGCTCTCAAATCCCACCAGTGTTGAAACGACATCAAAGGGAACTTAGTGCTTTTCAATCAGAACAAGAAGCAACTGACTATGATGATGCCATCACCA

TTGAAACAATCGAGGATTTTGACATTTACAGTGAGGACATAAAGCAAGGTCCCCGCAGCTTTCAACAGAAAACAAGGCACTATTTTATTGCAGCTGTGGA

ACGACTCTGGGACTATGGGATGAGTACATCTCATGTTCTACGAAATAG GTATCAAAGTGACAATGTACCTCAGTTCAAGAAAGTAGTTTTCCAGGAATT

TACTGATGGCTCCTTTAGTCAGCCCTTATATCGTGGAGAATTAAATGAACACCTGGGGTTGTTGGGCCCATATATAAGAGCAGAAGTTGAAGACAACATT

ATG GTAACTTTCAAAAACCAGGCCTCCCGTCCCTACTCCTTCTATTCTAGCCTCATTTCTTATAAAGAAGATCAGAGAGGAGAAGAACCTAGAAGAAAC

TTTGTCAAGCCTAATGAAACCAAAATTTATTTTTGGAAAGTACAACATCATATGGCACCCACAGAAGATGAGTTTGACTGCAAGGCCTGGGCTTATTTCT

CTGATGTTGATCTT GAAAGAGATATGCACTCGGGATTAATTGGACCCCTTCTGATTTGCCACGCGAACACACTGAATCCTGCTCATGGGAGACAAGTGT

CAGTACAGGAATTTGCTCTGCTTTTCACTATCTTTGATGAGACCAAGAGCTGGTACTTCACTGAAAACGTGAAAAGGAACTGCAAGACACCCTGCAATTT

CCAGATGGAAGACCCCACTTTGAAAGAGAATTATCGCTTCCATG CAATCAATGGTTATGTAATGGATACCCTACCAGGCTTAGTAATGGCTCAAGATCA

AAGGATTCGATGGTATCTTCTCAGCATGGGCAACAATGAGAACATCCAATCTATTCATTTCAGTGGACATGTTTTCACTGTACGGAAAAAAGAGGAGTAT

AAAATGGCAGTGTACAACCTCTACCCAG GTGTTTTTGAGACTCTGGAAATGATACCATCCAGAGCTGGAATATGGCGAGTAGAATGCCTTATTGGCGAG

CACTTACAGGCTGGGATGAGCACTCTTTTTCTGGTGTACAGCAAGC AGTGTCAGATTCCTCTTGGAATGGCTTCTGGAAGCATCCGTGATTTCCAGATT

ACAGCTTCAGGACATTATG GACAGTGGGCCCCAAACCTGGCAAGACTTCATTATTCCGGATCAATCAATGCCTGGAGTACCAAGGAGCCCTTTTCTTGG

ATCAAG - UNI35416 - GTAGATCTGTTGGCACCAATGATTGTTCATGGCATCAAGACTCAGGGTGCTCGTCAGAAATTTTCCAGCCTTTATATCTC

TCAATTTATCATCATGTATAGCCTGGATGGGAAGAAGTGGCTGAGTTATCAAGGAAATTCCACTGGAACCTTAATG - UNI35416 - GTTTTCTTTG

GCAATGTGGACTCATCTGGGATTAAGCATAATAGTTTTAATCCTCCAATTATTGCTCGATATATCCGTTTGCACCCCACTCATTCTAGCATCCGTAGTAC

TCTTCGCATGGAGTTGATGGGCTGTGATTTAAACA - UNI35416 - GTTGCAGCATACCATTGGGAATGGAAAGTAAAGTAATATCAGATACACAAA

TCACTGCCTCATCCTACTTCACCAACATGTTTGCTACTTGGTCTCCTTCACAAGCTCGACTTCACCTCCAGGGAAGGACTAATGCCTGGCGACCTCAG -

 UNI15119 - GTGAATGATCCAAAACAATGGTTGCAAGTGGACTTACAAAAGACAATGAAAGTCACTGGAATAATAACCCAGGGAGTGAAATCTCTCT

TTACCAGCATGTTTGTGAAAGAGTTCCTTATTTCCAGCAGTCAAGATGGCCATCACTGGACTCAAATTTTATACAATGGCAAGGTAAAG - UNI15119

 - GTTTTTCAGGGGAATCAGGACTCATCCACACCTATGATGAATTCTCTAGACCCACCATTACTCACTCGCTATCTTCGAATTCACCCCCAGATCTGGG

AGCACCAAATTGCTCTGAGGCTTGAGATTCTAGGATGTGAGGCCCAGCAGCAATACTGAGGTAGCCTCTGCATCACCTGCTTATTCCCCTTCCTCAGCTC

AAAGATTGTCTTAATGTTTTATTGCTGTGAAGAGACACTATGACCATGGCAACTCTTATAAAATAAAGCATTTAATCA
Translation
MQIALFACFFLSLFNFCSSAIRRYYLGAVELSWNYIQSDLLSVLHTDSR RFLPRMSTSFPFNTSIMYKKTVFVEYKDQLFNIAKPRPPWMG GLLGPTI

WTEVHDTVVITLKNMASHPVSLHAVGVSYWKASEG GDEYEDQTSQMEKEDDKVFPGESHTYVWQVLKENGPMASDPPCLTYSYMSHVDLVKDLNSGLIG

ALLVCKEG GSLSKERTQMLYQFVLLFAVFDEG GKSWHSETNDSYTQSMDSASARDWPKMHTVNGYVNRSLPG GLIGCHRKSVYWHVIGMGTTPEIHS

IFLEGHTFFVRNHRQASLEISPITFLTAQTLLIDLGQFLLFCHISSHKHD DGMEAYVKVDSCPEESQWQKKNNNEEMEDYDDDLYSEMDMFTLDYDSSP

FIQIRSVAKKYPKTWIHYISAEEEDWDYAPSVPTSDNG GSYKSQYLSNGPHRIGRKYKKVRFIAYTDETFKTRETIQHESGLLGPLLYGEVGDTLL II

FKNQASRPYNIYPHGITDVSPLHARRLPRG GIKHVKDLPIHPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFINPERDLASGLIGPLLICYKESVDQR

GNQ MMSDKRNVILFSIFDENQSWYITENMQRFLPNAAKTQPQDPGFQASNIMHS SINGYVFDSLELTVCLHEVAYWHILSVGAQTDFLSIFFSGYTFK

HKMVYEDTLTLFPFSGETVFMSMENPG GLWVLGCHNSDFRKRGMTALLKVSSCDKSTSDYYEEIYEDIPTQLVNENNVIDPRSFFQNTNHPNTRKKKFK

DSTIPKNDMEKIEPQFEEIAEMLKVQSVSVSDMLMLLGQSHPTPHGLFLSDGQEAIYEAIHDDHSPNAIDSNEGPSKVTQLRPESHHSEKIVFTPQPGLQ

LRSNKSLETTIEVKWKKLGLQVSSLPSNLMTTTILSDNLKATFEKTDSSGFPDMPVHSSSKLSTTAFGKKAYSLVGSHVPLNVSEENSDSNILDSTLMYS

QESLPRDNILSMENDRLLREKRFHGIALLTKDNTLFKDNVSLMKTNKTYNHSTTNEKLHTESPTSIENSTTDLQDAILKVNSEIQEVTALIHDGTLLGKN

STYLRLNHMLNRTTSTKNKDIFHRKDEDPIPQDEENTIMPFSKMLFLSESSNWFKKTNGNNSLNSEQEHSPKQLVYLMFKKYVKNQSFLSEKNKVTVEQD

GFTKNIGLKDMAFPHNMSIFLTTLSNVHENGRHNQEKNIQEEIEKEALIEEKVVLPQVHEATGSKNFLKDILILGTRQNISLYEVHVPVLQNITSINNST

NTVQIHMEHFFKRRKDKETNSEGLVNKTREMVKNYPSQKNITTQRSKRALGQFRLSTQWLKTINCSTQCIIKQIDHSKEMKKFITKSSLSDSSVIKSTTQ

TNSSDSHIVKTSAFPPIDLKRSPFQNKFSHVQASSYIYDFKTKSSRIQESNNFLKETKINNPSLAILPWNMFIDQGKFTSPGKSNTNSVTYKKRENIIFL

KPTLPEESGKIELLPQVSIQEEEILPTETSHGSPGHLNLMKEVFLQKIQGPTKWNKAKRHGESIKGKTESSKNTRSKLLNHHAWDYHYAAQIPKDMWKSK

EKSPEIISIKQEDTILSLRPHGNSHSIGANEKQNWPQRETTWVKQGQTQRTCSQIPPVLKRHQRELSAFQSEQEATDYDDAITIETIEDFDIYSEDIKQG

PRSFQQKTRHYFIAAVERLWDYGMSTSHVLRNR RYQSDNVPQFKKVVFQEFTDGSFSQPLYRGELNEHLGLLGPYIRAEVEDNIM VTFKNQASRPYSF

YSSLISYKEDQRGEEPRRNFVKPNETKIYFWKVQHHMAPTEDEFDCKAWAYFSDVDL ERDMHSGLIGPLLICHANTLNPAHGRQVSVQEFALLFTIFDE

TKSWYFTENVKRNCKTPCNFQMEDPTLKENYRFHA AINGYVMDTLPGLVMAQDQRIRWYLLSMGNNENIQSIHFSGHVFTVRKKEEYKMAVYNLYPG G

VFETLEMIPSRAGIWRVECLIGEHLQAGMSTLFLVYSKQ QCQIPLGMASGSIRDFQITASGHYG GQWAPNLARLHYSGSINAWSTKEPFSWIK - UN

I35416 - VDLLAPMIVHGIKTQGARQKFSSLYISQFIIMYSLDGKKWLSYQGNSTGTLM - UNI35416 - VFFGNVDSSGIKHNSFNPPIIARYI

RLHPTHSSIRSTLRMELMGCDLNS - UNI35416 - SCSIPLGMESKVISDTQITASSYFTNMFATWSPSQARLHLQGRTNAWRPQ - UNI15119 

- VNDPKQWLQVDLQKTMKVTGIITQGVKSLFTSMFVKEFLISSSQDGHHWTQILYNGKVK - UNI15119 - VFQGNQDSSTPMMNSLDPPLLTRYL

RIHPQIWEHQIALRLEILGCEAQQQY

For any suggestions or comments, please send an email to unitrap@crg.es