Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031207 (Msn)
Chromosomal location
Chr X: 93291381 - 93363892 (+)
Description
moesin Gene [Source:MGI (curated);Acc:Msn-001]
RefSeq_peptide
NP_034963.2 
UniGene
Mm.474813 Mm.138876 
MGI
MGI:97167 
Uniprot/SWISSPROT
P26041 
Uniprot/SPTREMBL
Q3UF33 B1AX70 Q05DU4 Q3TZQ2 
Human Ortholog
ENSG00000147065 (MSN)
Omim not available
UniTrap UNI4718
Vector Insertion
Chr X: 93291583 - 93337141
Public Clones (sanger) XS0095 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2303
Vector Insertion
Chr X: 93337288 - 93345958
Public Clones AF0021 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053137
Sequence
TTCCCCAAATCT ATCAGTGTGCGTGTCACCACCATGGATGCAGAGCTGGAGTTTGCCATTCAGCCCAACACCACTGGCAAGCAGCTGTTTGACCAG - 

UNI2303 - GTGGTGAAAACTATTGGTTTGAGGGAAGTTTGGTTCTTTGGTCTGCAGTACCAGGACACAAAAGCTTTCTCTACTTGGCTGAAACTCAAT

AAGAAG GTGACTGCACAGGATGTGCGGAAGGAAAGTCCATTGCTCTTCAAGTTCCGGGCCAAGTTCTACCCAGAGGATGTATCTGAAGAACTGATCCAG

GATATCACCCAGCGCCTGTTCTTTCTGCAAGTGAAGGAGGGCATTCTCAATGACGACATTTACTGTCCACCTGAAACTGCGGTCCTGTTGGCTTCTTATG

CCGTCCAGTCTAAGTATGGTGACTTCAATAAGGAAGTGCACAAGTCTGGCTACCTGGCTGGAGATAAGTTGCTTCCCCAAAG AGTCTTGGAGCAGCACA

AACTCAACAAGGACCAGTGGGAAGAGAGGATCCAGGTGTGGCATGAGGAGCACCGGGGCATGCTCAG GGAGGATGCTGTCCTGGAATATCTCAAGATTG

CTCAAGACCTGGAAATGTATGGTGTGAACTATTTCAGCATCAAGAACAAGAAAGGCTCAGAGCTATGGCTGGGCGTGGATGCCTTGGGTCTCAACATCTA

TGAGCAGAATGACAG ACTGACTCCTAAGATTGGCTTCCCGTGGAGTGAAATCAGGAATATCTCTTTCAATGATAAGAAATTTGTCATCAAGCCCATTGA

CAAAAAGGCCCCG GACTTTGTGTTCTATGCTCCCCGGCTTCGGATTAACAAGCGGATCTTGGCCCTGTGCATGGGAAATCATGAGCTGTACATGCGTCG

GCGCAAGCCTGACACCATTGAGGTGCAGCAGATGAAGGCCCAGGCTCGGGAAGAGAAGCACCAGAAGCAGATGGAGCG TGCTCTCCTGGAAAATGAGAA

GAAGAAGCGTGAGCTGGCTGAGAAAGAGAAGGAGAAGATTGAGCGGGAGAAGGAAGAGCTGATGGAGAAGCTGAAGCAGATTGAGGAGCAGACTAAGAAG

GCTCAGCAAG AGCTGGAAGAGCAGACCCGCAGGGCCCTAGAACTTGAGCAGGAACGGAAGCGTGCCCAGAGTGAGGCCGAAAAGCTAGCCAAGGAGCGT

CAAGAAGCTGAAGAAGCCAAAGAGGCCCTGCTGCAGGCTTCTCGGGACCAGAAGAAGACCCAGGAACAGCTG GCTTCAGAAATGGCAGAGCTGACGGCA

CGGATCTCCCAGTTGGAAATGGCTCGAAAGAAGAAGGAAAGTGAGGCTGTGGAATGGCAGCAAAAG GCCCAGATGGTACAGGAAGACTTGGAGAAGACT

CGTGCTGAGCTGAAGACTGCCATGAGTACACCTCATGTGGCAGAGCCTGCTGAGAATGAACATGATGAGCAGGATGAGAATGGAGCAGAGGCCAGTGCCG

AGCTGCGGGCTGATGCTATGGCCAAGGACCGCAGTGAGGAGGAACGTACCACTGAGGCAGAGAAGAATGAGCGTGTGCAGAAGCATCTGAAG GCCCTTA

CTTCAGAGCTGGCCAATGCCCGAGATGAGTCCAAGAAGACTGCCAATGACATGATCCATGCTGAGAACATGCGACTGGGACGAGACAAATACAAGACCCT

GCGCCAGATCCGGCAGGGCAACACCAAACAACGCATTGATGAGTTTGAGTCCATGTAGTGGGCGTCCAGCCTTCAGGGACCCCTCCTCCTTCTTCCTTGT

CCCCACACTCCCATAGTTTTGCCTAACTAACACTGTGCTGGAGCCACTAACTAGAAAAGCCTTGGAGCCATGCCAAACGTTCAGTATAGCCATGGGACCA

AACTTAATCTCCCCACTCATACCCTCGGGCAAACAAATGGCCCACTGTGGTGCCAATGGAATCTCCTTTTCCTTCTTTGTCACACTCATTCAACCTAGCT

CTCTAGAATAGAGCATTTCTCCCCGCCCCAGCTCAGAGACACGCATTCCTTTTGGTTTGACAAGCACCCCCTCCCCATATACACTTACTGTTGTCCTCTG

GGACTCATGTGTGAAGTAGGTTAACAGCTAGCTCCCATCCCTTGCCAGTCCTGTGATTTGCAAAGATGGAATATTGTGTTGTTTAGGGACAGAAGGAGGG

AATTGGCTTTATCATTTAGTATGTCAGATGACCTAGGATTTAGCCTCTTAATTAAGTCTATCCCTTTTACAGTTACTTAGGCTTTGTACCGATTGGAGGA

TAAAAGAGATGTTTAGCCATTCTTATTTCTTCTACCTCCCATATTGGACCTATTACAAATCTAGTCCCAGTGGGCCTTGTCTCTGTGTTTAGGGATTTAG

TTTCTAATCAAGATGGGATGAAGAGATAAAGGAAATAGTGCATTCAAGAGATTCACTAACAACCTAGAAAGGCCCCTGCCCCAGCACATCTTTGGAGCCT

TTCTTCTCTTGAGTGAGGTCTGTGGTCAGGGCTACCCCTGCCCATGATAGTCCAGGTTCTTGGTTCCTTTTCTAAATCTGTCCCTACCCTCTCCAATCCT

CAGATCTCTTCCAGCTAGGACAGAGAGGATGAGTACCCTCAAACCTAGCCAGTTGCATCTAAACTTGTTGCCACAAAGGAAGAAACTTTTTTGTACCTGG

CTTTAGTATTTTTCCTGCCAGGACTTCTAAACTACTTCCCCCAGAGCTAATTTGACCACTGTTCCTGTTTCACAGATACAAAATATGATGAGTAAGAGTA

GCCCTTGTCTGTCAGTCACCCAGCAATCCTCCCTCATCTTACCCAGTGCAAAGTGGTGAGTAGGCCCTGCTTCTGACAAATCTCTAACTCAGGCCTCATC

ACTCATTGTGCTGTCCCTTGGAGATACAGAAAGCTGCTGGGTATTCTGGCCTTGTCCCTTCACACCCCCACACCCTTTTCTCCACTTTGGAGCAGCTGCT

CCCCCTTTTTTGTCACATGTGTGCTCTTTTAATTTTTACCAGTATTATATATTCTAGTGATATCTAACAATATTGGTTTCTACCTTTTTTGCTAATGCAC

TATTAGAGATATTAGTCTTGGGAAAGGATCATTTTAGCTTCATTATTTTTTACTACTGTCACCCCACATCTGAGAAGAATATACTATATTAAAAATGATA

TTTTGCCAAAAACATTATGTAAGAAGATTTCAGTATTAGCGACTTACCTGTCACTATAGGTCATACAATACATTTAAAATGTACTTAGTATTTGGTTTTA

TTGTTCCTGTTTGCTTTTTCCCCAGGGTTCAGTCCCCAAAAGGCTGTCTTGTCCCTCTATGCAGTATCCTTAGTCCAGAGCATCCCTCAGCCCATGCCCC

TTTTACTTAATCTTGGGGAATCTTATATGCATTGCTGTGAATTATATTGACAGTTGGTGAGCTGTCTTATATTGGCTAAATTCAAACCTGGAATTGTGGG

GGCAATCTAGCTGCATTAAGGGCAATAACCCACCCCCCCATAGAGGCTGGGGAGAAGGGTAGGATTTATATTGAGGTTTTTTTTTTGTGTATTTTTGTTT

TTTAAATAATTGTTTTGGAGGGGTTTATGCTCAATCTGTGTTCTATTTCAGTGCCAATAAAATTTAGGAAGACTTCA
Translation
FPKS ISVRVTTMDAELEFAIQPNTTGKQLFDQ - UNI2303 - VVKTIGLREVWFFGLQYQDTKAFSTWLKLNKK VTAQDVRKESPLLFKFRAKFY

PEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQR RVLEQHKLNKDQWEERIQVWHEEHRGML

R REDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDR RLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAP DFVFYAPRLRINK

RILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMER RALLENEKKKRELAEKEKEKIEREKEELMEKLKQIEEQTKKAQQE ELEEQTRRALE

LEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQL ASEMAELTARISQLEMARKKKESEAVEWQQK AQMVQEDLEKTRAELKTAMSTPHV

AEPAENEHDEQDENGAEASAELRADAMAKDRSEEERTTEAEKNERVQKHLK ALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRI

DEFESM
Transcript ENSMUST00000117399
Sequence
GGCTCTTTCCTGGGTGGGGTTTGTAAAGTCGTGGCCCGTTAGCAGGAAGCGGAGCAGTCGCCCAACGCTAGAGTGGGACCCAATCTGAGCACCCGGTTCT

CCGGAGTCCTTGCCGAAGTGTACTGCGCGCTCAGAGCAGCCCGACAGTTTCCAGCCAAACTTCACCAACTCCTCTGCCCTTGCCGCCACCATGCCGAAGA

CG - UNI4718 - ATCAGTGTGCGTGTCACCACCATGGATGCAGAGCTGGAGTTTGCCATTCAGCCCAACACCACTGGCAAGCAGCTGTTTGACCAG 

- UNI2303 - GTGGTGAAAACTATTGGTTTGAGGGAAGTTTGGTTCTTTGGTCTGCAGTACCAGGACACAAAAGCTTTCTCTACTTGGCTGAAACTCA

ATAAGAAG GTGACTGCACAGGATGTGCGGAAGGAAAGTCCATTGCTCTTCAAGTTCCGGGCCAAGTTCTACCCAGAGGATGTATCTGAAGAACTGATCC

AGGATATCACCCAGCGCCTGTTCTTTCTGCAAGTGAAGGAGGGCATTCTCAATGACGACATTTACTGTCCACCTGAAACTGCGGTCCTGTTGGCTTCTTA

TGCCGTCCAGTCTAAGTATGGTGACTTCAATAAGGAAGTGCACAAGTCTGGCTACCTGGCTGGAGATAAGTTGCTTCCCCAAAG AGTCTTGGAGCAGCA

CAAACTCAACAAGGACCAGTGGGAAGAGAGGATCCAGGTGTGGCATGAGGAGCACCGGGGCATGCTCAG GGAGGATGCTGTCCTGGAATATCTCAAGAT

TGCTCAAGACCTGGAAATGTATGGTGTGAACTATTTCAGCATCAAGAACAAGAAAGGCTCAGAGCTATGGCTGGGCGTGGATGCCTTGGGTCTCAACATC

TATGAGCAGAATGACAG ACTGACTCCTAAGATTGGCTTCCCGTGGAGTGAAATCAGGAATATCTCTTTCAATGATAAGAAATTTGTCATCAAGCCCATT

GACAAAAAGGCCCCG GACTTTGTGTTCTATGCTCCCCGGCTTCGGATTAACAAGCGGATCTTGGCCCTGTGCATGGGAAATCATGAGCTGTACATGCGT

CGGCGCAAGCCTGACACCATTGAGGTGCAGCAGATGAAGGCCCAGGCTCGGGAAGAGAAGCACCAGAAGCAGATGGAGCG TGCTCTCCTGGAAAATGAG

AAGAAGAAGCGTGAGCTGGCTGAGAAAGAGAAGGAGAAGATTGAGCGGGAGAAGGAAGAGCTGATGGAGAAGCTGAAGCAGATTGAGGAGCAGACTAAGA

AGGCTCAGCAAG AGCTGGAAGAGCAGACCCGCAGGGCCCTAGAACTTGAGCAGGAACGGAAGCGTGCCCAGAGTGAGGCCGAAAAGCTAGCCAAGGAGC

GTCAAGAAGCTGAAGAAGCCAAAGAGGCCCTGCTGCAGGCTTCTCGGGACCAGAAGAAGACCCAGGAACAGCTG GCTTCAGAAATGGCAGAGCTGACGG

CACGGATCTCCCAGTTGGAAATGGCTCGAAAGAAGAAGGAAAGTGAGGCTGTGGAATGGCAGCAAAAG GCCCAGATGGTACAGGAAGACTTGGAGAAGA

CTCGTGCTGAGCTGAAGACTGCCATGAGTACACCTCATGTGGCAGAGCCTGCTGAGAATGAACATGATGAGCAGGATGAGAATGGAGCAGAGGCCAGTGC

CGAGCTGCGGGCTGATGCTATGGCCAAGGACCGCAGTGAGGAGGAACGTACCACTGAGGCAGAGAAGAATGAGCGTGTGCAGAAGCATCTGAAG GCCCT

TACTTCAGAGCTGGCCAATGCCCGAGATGAGTCCAAGAAGACTGCCAATGACATGATCCATGCTGAGAACATGCGACTGGGACGAGACAAATACAAGACC

CTGCGCCAGATCCGGCAGGGCAACACCAAACAACGCATTGATGAGTTTGAGTCCATGTAGTGGGCGTCCAGCCTTCAGGGACCCCTCCTCCTTCTTCCTT

GTCCCCACACTCCCATAGTTTTGCCTAACTAACACTGTGCTGGAGCCACTAACTAGAAAAGCCTTGGAGCCATGCCAAACGTTCAGTATAGCCATGGGAC

CAAACTTAATCTCCCCACTCATACCCTCGGGCAAACAAATGGCCCACTGTGGTGCCAATGGAATCTCCTTTTCCTTCTTTGTCACACTCATTCAACCTAG

CTCTCTAGAATAGAGCATTTCTCCCCGCCCCAGCTCAGAGACACGCATTCCTTTTGGTTTGACAAGCACCCCCTCCCCATATACACTTACTGTTGTCCTC

TGGGACTCATGTGTGAAGTAGGTTAACAGCTAGCTCCCATCCCTTGCCAGTCCTGTGATTTGCAAAGATGGAATATTGTGTTGTTTAGGGACAGAAGGAG

GGAATTGGCTTTATCATTTAGTATGTCAGATGACCTAGGATTTAGCCTCTTAATTAAGTCTATCCCTTTTACAGTTACTTAGGCTTTGTACCGATTGGAG

GATAAAAGAGATGTTTAGCCATTCTTATTTCTTCTACCTCCCATATTGGACCTATTACAAATCTAGTCCCAGTGGGCCTTGTCTCTGTGTTTAGGGATTT

AGTTTCTAATCAAGATGGGATGAAGAGATAAAGGAAATAGTGCATTCAAGAGATTCACTAACAACCTAGAAAGGCCCCTGCCCCAGCACATCTTTGGAGC

CTTTCTTCTCTTGAGTGAGGTCTGTGGTCAGGGCTACCCCTGCCCATGATAGTCCAGGTTCTTGGTTCCTTTTCTAAATCTGTCCCTACCCTCTCCAATC

CTCAGATCTCTTCCAGCTAGGACAGAGAGGATGAGTACCCTCAAACCTAGCCAGTTGCATCTAAACTTGTTGCCACAAAGGAAGAAACTTTTTTGTACCT

GGCTTTAGTATTTTTCCTGCCAGGACTTCTAAACTACTTCCCCCAGAGCTAATTTGACCACTGTTCCTGTTTCACAGATACAAAATATGATGAGTAAGAG

TAGCCCTTGTCTGTCAGTCACCCAGCAATCCTCCCTCATCTTACCCAGTGCAAAGTGGTGAGTAGGCCCTGCTTCTGACAAATCTCTAACTCAGGCCTCA

TCACTCATTGTGCTGTCCCTTGGAGATACAGAAAGCTGCTGGGTATTCTGGCCTTGTCCCTTCACACCCCCACACCCTTTTCTCCACTTTGGAGCAGCTG

CTCCCCCTTTTTTGTCACATGTGTGCTCTTTTAATTTTTACCAGTATTATATATTCTAGTGATATCTAACAATATTGGTTTCTACCTTTTTTGCTAATGC

ACTATTAGAGATATTAGTCTTGGGAAAGGATCATTTTAGCTTCATTATTTTTTACTACTGTCACCCCACATCTGAGAAGAATATACTATATTAAAAATGA

TATTTTGCCAAAAACATTATGTAAGAAGATTTCAGTATTAGCGACTTACCTGTCACTATAGGTCATACAATACATTTAAAATGTACTTAGTATTTGGTTT

TATTGTTCCTGTTTGCTTTTTCCCCAGGGTTCAGTCCCCAAAAGGCTGTCTTGTCCCTCTATGCAGTATCCTTAGTCCAGAGCATCCCTCAGCCCATGCC

CCTTTTACTTAATCTTGGGGAATCTTATATGCATTGCTGTGAATTATATTGACAGTTGGTGAGCTGTCTTATATTGGCTAAATTCAAACCTGGAATTGTG

GGGGCAATCTAGCTGCATTAAGGGCAATAACCCACCCCCCCATAGAGGCTGGGGAGAAGGGTAGGATTTATATTGAGGTTTTTTTTTTGTGTATTTTTGT

TTTTTAAATAATTGTTTTGGAGGGGTTTATGCTCAATCTGTGTTCTATTTCAGTGCCAATAAAATTTAGGAAGACTTC
Translation
MPKT - UNI4718 - ISVRVTTMDAELEFAIQPNTTGKQLFDQ - UNI2303 - VVKTIGLREVWFFGLQYQDTKAFSTWLKLNKK VTAQDVRKE

SPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQR RVLEQHKLNKDQWEER

IQVWHEEHRGMLR REDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDR RLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAP D

FVFYAPRLRINKRILALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQMER RALLENEKKKRELAEKEKEKIEREKEELMEKLKQIEEQTKKAQQE

 ELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQL ASEMAELTARISQLEMARKKKESEAVEWQQK AQMVQEDLEKTR

AELKTAMSTPHVAEPAENEHDEQDENGAEASAELRADAMAKDRSEEERTTEAEKNERVQKHLK ALTSELANARDESKKTANDMIHAENMRLGRDKYKTL

RQIRQGNTKQRIDEFESM

For any suggestions or comments, please send an email to unitrap@crg.es