Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031256 (Cstf2)
Chromosomal location
Chr X: 130593726 - 130621360 (+)
Description
cleavage stimulation factor, 3' pre-RNA subunit 2 Gene [Source:MGI (curated);Acc:Cstf2-001]
RefSeq_dna
NM_133196 
RefSeq_peptide
NP_573459.1 
UniGene
Mm.413319 
MGI
MGI:1343054 
Uniprot/SWISSPROT
Q8BIQ5 
Uniprot/SPTREMBL
A2AEK3 A2AEK2 A2AEJ9 A2AEK1 A2AEK0 A2AEJ8 
Human Ortholog
ENSG00000101811 (CSTF2)
Omim not available
UniTrap UNI12490
Vector Insertion
Chr X: 130593962 - 130595182
Public Clones A025F02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14813
Vector Insertion
Chr X: 130600924 - 130604383
Public Clones PST11947-NL (escells) PST11947-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20362
Vector Insertion
Chr X: 130615856 - 130618770
Public Clones not available
Private Clones OST365529 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113281
Sequence
ACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAGACCCTGCGGTGGATCGTTCCCTGCGCTCCGTCTTCG - UNI12490 - TGGGAAACATCC

CTTATGAAGCTACTGAAGAACAACTGAAGGACATTTTCTCTGAGGTTGGGCCTGTTGTTAGTTTCAG ATTGGTATACGATAGGGAGACAGGAAAACCAA

AGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACAGCACTTAGTGCCATGCGGAACTTGAATGGGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGA

TAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA GCCTTGGCACTGGTGCACCTGTCATAGAGTCACCTTATGGAGAAAGCATCAGCCCTGAGGA

TGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTCCACCAGAACAGATGTTTGAGTTGATGAAACAAATGAAG CTCTGTGTCCAGAATAGTCCCCA

GGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGGCTTATGCTTTGTTGCAAGCACAGGTAGTGATGAGAATTGTGGATCCTGAGATTGCGCTG AA

AATTCTGCATCGCCAGACAAATATCCCAACGCTGATTTCAGGCAACCCTCAGCCAGTTCATGTTGCTGGGCCTGGCTCAGGACCCAATGTTTCAATGAAC

CAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG GGTGGAATGCATGTCAATGGCGCACCTCCTATGATGCAAGCTTCTATGCCAGGTGGAGTTCCA

GCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGGCCCTGGTTCCTTAGCCCCTGCAG - UNI14813 - GAGTTATGCAAGCCCAAGTTGGAAT

GCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG GAACCTTACAGCACTCGCCCGTGGGACCCGCCGGGCCTGCATCAATTGAGCGAGTTCAAG 

TGCCAATGCAAGACCCCAGAGCAGCTATGCAGCGGGGAGCCTTGCCTACCAACGTCCCAACTCCTCGTGGTCTTTTAGGTGATGCTCCCAATGACCCGCG

GGGAGGCACTTTAATGACTGTAACTGGAGACGTAGAACCTAG AGCTTACCTGGGACCACCACCACCACCTCATCAGGGCCCACCCATGCACCATGTTCC

TGGTCATGAAGGTCGTGGACCGCCTCCACATGACATGAGAGGAGGACCCCTAGCTGAGCCGAGACCTTTAATGGCAGAACCAAGAGGACCCATGCTAGAT

CAGAGGGGCCCACCTCTGGATGCCAGAG GTGGAAGAGATCCCCGAGGATTAGATGCACGGGGGATGGAGGCCAGAGCCATGGAAGCAAGAGGACTAGAT

GCCAGAGGACTGGAAGCCCGTGCCATGGAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAGCCCGTGCCATGGAAGCCCGTGCCATGGAGGCTCGTGCCA

TGGAGGCCAGAGGCATGGACACCAGAGGCCCAGTACCTGGACCTAGAGGACCTATGCCTAGTGGAATCCAAGGTCCCAATCCAATGAACATGGGGGCAGT

TGTTCCCCAGGGATCCAGACAG GTACCAGTCATGCAGGGAGCAGGCATGCAAGGAGCAAGCATGCAAGGTGGAAGCCAGCCTGGTGGCTTTAGTCCTGG

ACAGAGCCAAGTCACACCCCAGGATCATGAGAAG GCTGCTTTGATTATGCAGGTCCTTCAGCTCACTGCAGACCAGATCGCCATGCTGCCTCCTGAGCA

AAGACAGAGTATCCTAATCTTAAAGGAACAGATACAGAAATCCACTGGGGCACCTTGAAAG - UNI20362 - GTTCTCAAAATAGCTGGCAACAAAT

CTGGAAATGTAATTCCATAACATTTTTGAAATTTTGAAAACATAATGACGTCTGCATCCGAACCTCCCCGGATGAGGCAGATGGCGCCAGGTGGAGGTCT

TACATCGCCATTGCTCCAAAGGAAAGCAGTTTATTCTGTTGTCGTAGTGTGTATATTTTCTGTGACATTAAATAAACTTTGAACACAAGTTTAACATACT

ACAAATTGATATACATAATCCTTTTGCTTTTAAGAAGCTAACAGCAAGGATGTAAGCTTAACTGTGATTTCTAACTGCAGCATCATTCTTTAATCTTACA

TTGCCATAGCTCTATTCTTACTTTAGCATAAGCATTTATTCTTCTTAATGATACTTGAGAATTTCTCAGAAACAATGTTTTCAGGAACTTTGATTTTTGT

TGAATTTGCTTTCAGTAAAGTAATAACACTTTACCCCGTGAAAACTTTCTAGAGTCTCAGAGCTTTCTGGGAGGAAAACAAAAAAGCACGTGGTTAGAAC

TAAAAATGATCAGAAGGCCAACAAGGGAAGAGCGTACCACAACAGTGTGTTTGCTTCCAGAAATGCCAGTTATCCAAGTGTGTTGTTTGGTCAGTAGCAG

GTGTGAACATACATAGGACAAAGGCTGTCGTGGCACTGGTTTGCAAAAGATTGTCGTAAAGCTCTCCTGTCTAGGTAGCCCGCTTTACAAGTTTAAAAAG

GCACTGGTTTTCCACATGGTCAAATTTAATAAAGAAAACCAAGTGAACAAAATATATTCCAATCTTTCAGAAAATCACAAAGCTTTCAGCCCTGTCATCT

TAACTAAATCCATTCCAAGAACTTCAAACAGAAAACCCTAAAACTTTGACATTTTCAAGTCTTTAAAGAGGACCAAGTATAGAGCACCGGACGGCAAACT

GCCCGTTATGGTTGCCTGCTTCTTTCCAAGTCCGACCAACTTGGAAGGCAATTAGTGCCATTAGCCTGTGCTAACCTGCAGGTTGCCTTGCCTTTTGTTC

TCCCACAGTGGCATTAAGGAGGAACTTGGTTTCTCTCCACCAGTTTGACCTCAAGACATTTGAAGAGTTGCCTTAATAATTATTAAGTTTACTAGCACTA

ATTGTAAGCTTATTTGTATTCCCAGATCCCTACCCTCTGCATTAGGATTATGGGCAGGTGAATTAAAATCACTACTTAAGGCATAAAAAGCATAGTAGTA

CATTGCTTATATGCCAAGAAAAAGAAAGCAAAGATATTAAAATTGAAGGATTTTTCTCCATATATTTTTAATGAAAATTTGCTGGATCTGTCATATTATA

ACCTGTCAAGAAAAGTATAAAACAACAAGCACTCCTGCCTGCCTATTCCACTCATGCCCAGTTCAACCCCGATGGATGTTAATTATGCATGCACTTCTTT

GTCATTACCCTCTGTGCCTCCTGCAGAAGCAGTCCTTGCTGTGTTGGTTTTGGCAGCTGTCTTGACTTAAAAGCACCAATGTATTTAGATGCAGAGACCA

AGAGCAAAGTATTTCTAGTTAGGAACTTGGGTTTTACACAACCAGTTCCAAATCAAGATAAGTGAAGCTGAAGTGATTTGGGAAACAGTTGTCTAGTAGA

AACCATGTCCTGGAAAGCCAGCACATTTTCCCGAAGCCTCAGTAAACTTAATTTGCTTAGCAGGCATTCAGGTGACTAAGTTGACAAGAGCAGTGGCATC

CCAATTCATCACTATGGAAACACTCATCAGTGGTTGGTTGGTTTGTTTGCTGTTATTTTTTACTGTTGTAATAATACAGTTAGCTACCCCACGTTCATGA

TCTGCCTTTATTATGTTCAAAACTAATGACTGAAAAATAATCCCACAAATCCTTCAGGCTGTAAGTTCCTAGATAATTGAAAACAAAAATGTGTTCACTT

TTGGTTAATTAATGGTACAAATTAGATGGTCTAGTGCTAACTCTATAGATTCATTCTGCTAAATGTATGAGGTCAACTGCCTGAGTACAGTGAAGTGTGG

AGTTTTTTCTCCCTGAAGAGCCTGCACCTTTTTGTGTAATTCACCATAACTAACATCCCAGAGCCAGCGTGCTTATTGTCCTGGTTGATAGGAAAAATCA

ACATTTTTGTAGGAAAAAGAGTGACATTTAGTGGATGATTCCTGATTGAGTAAGACCTGGAAAATAGCCAAAATTATAACTTTTTTCTTTTTATAATACA

TTCATTAACAAACTCCTTTAACAACAACAAAAAGCATAAAAGAGCTTCAGTTCAATTATCTCATGATGTACGTCAGGCCTTTCCAGTTATTCCAAACAAT

ACAAAGTGACAATATAGTTGGCTTCTAACTATAGTACAAATTTGATTACAGTTAATATACTTAAGATATTACTAGGAAATTGTTCAATAAGCAAAAAGGA

AAGTCAATTATTTTGACAAAGTAACGTGTAAATTGTTGGTCACACTGGATTAACTCATGTAACAATGTACTTAGTGGGTGATATGGGAGTGGGAAGCTTG

GTCGTTCTATGTTGTTTATTTATGATTGTTGTTCTGTCGTGGATTCAATAAATATTTTAAAAGTC
Translation
 - UNI12490 -     MNQQNPQAPQAQSL GGMHVNGAPPMMQASMPGGVPAPVQMAAAVGGPGPGSLAPAG - UNI14813 - GVMQAQVGMQG

AGPVPMERGQG GTLQHSPVGPAGPASIERVQV VPMQDPRAAMQRGALPTNVPTPRGLLGDAPNDPRGGTLMTVTGDVEPR RAYLGPPPPPHQGPPMH

HVPGHEGRGPPPHDMRGGPLAEPRPLMAEPRGPMLDQRGPPLDAR    - UNI20362 - 
Transcript ENSMUST00000113283
Sequence
ACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAGACCCTGCGGTGGATCGTTCCCTGCGCTCCGTCTTCG - UNI12490 - TGGGAAACATCC

CTTATGAAGCTACTGAAGAACAACTGAAGGACATTTTCTCTGAGGTTGGGCCTGTTGTTAGTTTCAG ATTGGTATACGATAGGGAGACAGGAAAACCAA

AGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACAGCACTTAGTGCCATGCGGAACTTGAATGGGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGA

TAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA GCCTTGGCACTGGTGCACCTGTCATAGAGTCACCTTATGGAGAAAGCATCAGCCCTGAGGA

TGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTCCACCAGAACAGATGTTTGAGTTGATGAAACAAATGAAG CTCTGTGTCCAGAATAGTCCCCA

GGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGGCTTATGCTTTGTTGCAAGCACAGGTAGTGATGAGAATTGTGGATCCTGAGATTGCGCTG AA

AATTCTGCATCGCCAGACAAATATCCCAACGCTGATTTCAGGCAACCCTCAGCCAGTTCATGTTGCTGGGCCTGGCTCAGGACCCAATGTTTCAATGAAC

CAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG GGTGGAATGCATGTCAATGGCGCACCTCCTATGATGCAAGCTTCTATGCCAGGTGGAGTTCCA

GCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGGCCCTGGTTCCTTAGCCCCTGCAG - UNI14813 - GAGTTATGCAAGCCCAAGTTGGAAT

GCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG GAACCTTACAGCACTCGCCCGTGGGACCCGCCGGGCCTGCATCAATTGAGCGAGTTCAAG 

GGCAGAGAACATGGATGATATGGGCATCTGTCCGAGGCTCTACTCCCTCCCTACTGGTGTCAGGAGGCTTGGATGGAATTGCAGTCT GTGATGCTCCCA

ATGACCCGCGGGGAGGCACTTTAATGACTGTAACTGGAGACGTAGAACCTAG AGCTTACCTGGGACCACCACCACCACCTCATCAGGGCCCACCCATGC

ACCATGTTCCTGGTCATGAAGGTCGTGGACCGCCTCCACATGACATGAGAGGAGGACCCCTAGCTGAGCCGAGACCTTTAATGGCAGAACCAAGAGGACC

CATGCTAGATCAGAGGGGCCCACCTCTGGATGCCAGAG GTGGAAGAGATCCCCGAGGATTAGATGCACGGGGGATGGAGGCCAGAGCCATGGAAGCAAG

AGGACTAGATGCCAGAGGACTGGAAGCCCGTGCCATGGAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAGCCCGTGCCATGGAAGCCCGTGCCATGGAG

GCTCGTGCCATGGAGGCCAGAGGCATGGACACCAGAGGCCCAGTACCTGGACCTAGAGGACCTATGCCTAGTGGAATCCAAGGTCCCAATCCAATGAACA

TGGGGGCAGTTGTTCCCCAGGGATCCAGACAG GTACCAGTCATGCAGGGAGCAGGCATGCAAGGAGCAAGCATGCAAGGTGGAAGCCAGCCTGGTGGCT

TTAGTCCTGGACAGAGCCAAGTCACACCCCAGGATCATGAGAAG GCTGCTTTGATTATGCAGGTCCTTCAGCTCACTGCAGACCAGATCGCCATGCTGC

CTCCTGAGCAAAGACAGAGTATCCTAATCTTAAAGGAACAGATACAGAAATCCACTGGGGCACCTTGAAAG - UNI20362 - GTTCTCAAAATAGCT

GGCAACAAATCTGGAAATGTAATTCCATAACATTTTTGAAATTTTGAAAACATAATGACGTCTGCATCCGAACCTCCCCGGATGAGGCAGATGGCGCCAG

GTGGAGGTCTTACATCGCCATTGCTCCAAAGGAAAGCAGTTTATTCTGTTGTCGTAGTGTGTATATTTTCTGTGACATTAAATAAACTTTGAACACAAGT

TTAACATACTACAAATTGATATACATAATCCTTTTGCTTTTAAGAAGCTAACAGCAAGGATGTAAGCTTAACTGTGATTTCTAACTGCAGCATCATTCTT

TAATCTTACATTGCCATAGCTCTATTCTTACTTTAGCATAAGCATTTATTCTTCTTAATGATACTTGAGAATTTCTCAGAAACAATGTTTTCAGGAACTT

TGATTTTTGTTGAATTTGCTTTCAGTAAAGTAATAACACTTTACCCCGTGAAAACTTTCTAGAGTCTCAGAGCTTTCTGGGAGGAAAACAAAAAAGCACG

TGGTTAGAACTAAAAATGATCAGAAGGCCAACAAGGGAAGAGCGTACCACAACAGTGTGTTTGCTTCCAGAAATGCCAGTTATCCAAGTGTGTTGTTTGG

TCAGTAGCAGGTGTGAACATACATAGGACAAAGGCTGTCGTGGCACTGGTTTGCAAAAGATTGTCGTAAAGCTCTCCTGTCTAGGTAGCCCGCTTTACAA

GTTTAAAAAGGCACTGGTTTTCCACATGGTCAAATTTAATAAAGAAAACCAAGTGAACAAAATATATTCCAATCTTTCAGAAAATCACAAAGCTTTCAGC

CCTGTCATCTTAACTAAATCCATTCCAAGAACTTCAAACAGAAAACCCTAAAACTTTGACATTTTCAAGTCTTTAAAGAGGACCAAGTATAGAGCACCGG

ACGGCAAACTGCCCGTTATGGTTGCCTGCTTCTTTCCAAGTCCGACCAACTTGGAAGGCAATTAGTGCCATTAGCCTGTGCTAACCTGCAGGTTGCCTTG

CCTTTTGTTCTCCCACAGTGGCATTAAGGAGGAACTTGGTTTCTCTCCACCAGTTTGACCTCAAGACATTTGAAGAGTTGCCTTAATAATTATTAAGTTT

ACTAGCACTAATTGTAAGCTTATTTGTATTCCCAGATCCCTACCCTCTGCATTAGGATTATGGGCAGGTGAATTAAAATCACTACTTAAGGCATAAAAAG

CATAGTAGTACATTGCTTATATGCCAAGAAAAAGAAAGCAAAGATATTAAAATTGAAGGATTTTTCTCCATATATTTTTAATGAAAATTTGCTGGATCTG

TCATATTATAACCTGTCAAGAAAAGTATAAAACAACAAGCACTCCTGCCTGCCTATTCCACTCATGCCCAGTTCAACCCCGATGGATGTTAATTATGCAT

GCACTTCTTTGTCATTACCCTCTGTGCCTCCTGCAGAAGCAGTCCTTGCTGTGTTGGTTTTGGCAGCTGTCTTGACTTAAAAGCACCAATGTATTTAGAT

GCAGAGACCAAGAGCAAAGTATTTCTAGTTAGGAACTTGGGTTTTACACAACCAGTTCCAAATCAAGATAAGTGAAGCTGAAGTGATTTGGGAAACAGTT

GTCTAGTAGAAACCATGTCCTGGAAAGCCAGCACATTTTCCCGAAGCCTCAGTAAACTTAATTTGCTTAGCAGGCATTCAGGTGACTAAGTTGACAAGAG

CAGTGGCATCCCAATTCATCACTATGGAAACACTCATCAGTGGTTGGTTGGTTTGTTTGCTGTTATTTTTTACTGTTGTAATAATACAGTTAGCTACCCC

ACGTTCATGATCTGCCTTTATTATGTTCAAAACTAATGACTGAAAAATAATCCCACAAATCCTTCAGGCTGTAAGTTCCTAGATAATTGAAAACAAAAAT

GTGTTCACTTTTGGTTAATTAATGGTACAAATTAGATGGTCTAGTGCTAACTCTATAGATTCATTCTGCTAAATGTATGAGGTCAACTGCCTGAGTACAG

TGAAGTGTGGAGTTTTTTCTCCCTGAAGAGCCTGCACCTTTTTGTGTAATTCACCATAACTAACATCCCAGAGCCAGCGTGCTTATTGTCCTGGTTGATA

GGAAAAATCAACATTTTTGTAGGAAAAAGAGTGACATTTAGTGGATGATTCCTGATTGAGTAAGACCTGGAAAATAGCCAAAATTATAACTTTTTTCTTT

TTATAATACATTCATTAACAAACTCCTTTAACAACAACAAAAAGCATAAAAGAGCTTCAGTTCAATTATCTCATGATGTACGTCAGGCCTTTCCAGTTAT

TCCAAACAATACAAAGTGACAATATAGTTGGCTTCTAACTATAGTACAAATTTGATTACAGTTAATATACTTAAGATATTACTAGGAAATTGTTCAATAA

GCAAAAAGGAAAGTCAATTATTTTGACAAAGTAACGTGTAAATTGTTGGTCACACTGGATTAACTCATGTAACAATGTACTTAGTGGGTGATATGGGAGT

GGGAAGCTTGGTCGTTCTATGTTGTTTATTTATGATTGTTGTTCTGTCGTGGATTCAATAAATATTTTAAAAGTC
Translation
 - UNI12490 -   MK LCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIAL KILHRQTNIPTLISGNPQPVHVAGPGSGPNVSMNQQNPQA

PQAQSL GGMHVNGAPPMMQASMPGGVPAPVQMAAAVGGPGPGSLAPAG - UNI14813 - GVMQAQVGMQGAGPVPMERGQG GTLQHSPVGPAGPA

SIERVQG GQRTWMIWASVRGSTPSLLVSGGLDGIAVC CDAPNDPRGGTLMTVTGDVEPR RAYLGPPPPPHQGPPMHHVPGHEGRGPPPHDMRGGPLA

EPRPLMAEPRGP    - UNI20362 - 
Transcript ENSMUST00000113286
Sequence
GACCGCGGTGAGGCGCGCGGCCGGGCTCCGCGGCGGCGCTTCGGGGCCAGGTGCTTCCGGCTCCCACCGGACGGAGGCGGGCTGGGCCGTGGTCTCGCTC

GGCCGCGGAAGTGTGCTTTAGCGCACCGGAAGCCACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAGACCCTGCGGTGGATCGTTCCCTGCGCTC

CGTCTTCG - UNI12490 - TGGGAAACATCCCTTATGAAGCTACTGAAGAACAACTGAAGGACATTTTCTCTGAGGTTGGGCCTGTTGTTAGTTTCA

G ATTGGTATACGATAGGGAGACAGGAAAACCAAAGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACAGCACTTAGTGCCATGCGGAACTTGAATG

GGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGATAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA GCCTTGGCACTGGTGCACCTGTCATAG

AGTCACCTTATGGAGAAAGCATCAGCCCTGAGGATGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTCCACCAGAACAGATGTTTGAGTTGATGAA

ACAAATGAAG CTCTGTGTCCAGAATAGTCCCCAGGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGGCTTATGCTTTGTTGCAAGCACAGGTAGT

GATGAGAATTGTGGATCCTGAGATTGCGCTG AAAATTCTGCATCGCCAGACAAATATCCCAACGCTGATTTCAGGCAACCCTCAGCCAGTTCATGTTGC

TGGGCCTGGCTCAGGACCCAATGTTTCAATGAACCAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG GGTGGAATGCATGTCAATGGCGCACCTCC

TATGATGCAAGCTTCTATGCCAGGTGGAGTTCCAGCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGGCCCTGGTTCCTTAGCCCCTGCAG - UN

I14813 - GAGTTATGCAAGCCCAAGTTGGAATGCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG TGCCAATGCAAGACCCCAGAGCAGCTA

TGCAGCGGGGAGCCTTGCCTACCAACGTCCCAACTCCTCGTGGTCTTTTAGGTGATGCTCCCAATGACCCGCGGGGAGGCACTTTAATGACTGTAACTGG

AGACGTAGAACCTAG AGCTTACCTGGGACCACCACCACCACCTCATCAGGGCCCACCCATGCACCATGTTCCTGGTCATGAAGGTCGTGGACCGCCTCC

ACATGACATGAGAGGAGGACCCCTAGCTGAGCCGAGACCTTTAATGGCAGAACCAAGAGGACCCATGCTAGATCAGAGGGGCCCACCTCTGGATGCCAGA

G GTGGAAGAGATCCCCGAGGATTAGATGCACGGGGGATGGAGGCCAGAGCCATGGAAGCAAGAGGACTAGATGCCAGAGGACTGGAAGCCCGTGCCATG

GAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAGCCCGTGCCATGGAAGCCCGTGCCATGGAGGCTCGTGCCATGGAGGCCAGAGGCATGGACACCAGAG

GCCCAGTACCTGGACCTAGAGGACCTATGCCTAGTGGAATCCAAGGTCCCAATCCAATGAACATGGGGGCAGTTGTTCCCCAGGGATCCAGACAGGTAAT

GCTTGTAGCATATACATAAAATCTTAATGTATTCAAGAATTGGTTACTAAGCCTGATTTTGTTTTAATTTTTGTAAGTGATTTTGGTTTGTCTCCCCAGT

GCAGAGTAATCTCTGAGCTCTACATTTTCAGGTTTTTCTAAATGAAATAGCCCCCAAAACTGAAACCTACAGGTTCATGTGAGAAGACAATACAAACAGG

CCTCAGTGACGCCCCTACCCCCAGCCCGTCCCCTGCGTCTCTCAGGCCAGTTGAAAACCTCTACCAGGTGATTCCAATGTGTGACCCTGATTACAGCATT

TGAGCAGCTGCATATTGGGTGTTTACGTTACGTTCATAACAGGAGCAAAATCCCAGTTATGAAGTAGCAATGAAAATTTGTGGGTGGGTCCCCACAACCT

GAGGAAATATATTAAAGGGTTGCAGCATTAGGAAGGTTGAGAACCACTGATTAAGATCATCTCAGGGTGACAGAAACCTATGTAGATTTCTTGTCATCAC

AACATCTAAATGAACAGTGACATAGAAAAGGCAGTCTGCATTTATTCTGGAGCTGCAGTTTGTCTCTTCTTTGTCTCTGTCAGTTGGTTTGCTCCAGTTG

TGCCTATGGGATGCTTTGTAGTAGTCATTTCCTCATTTATCATCTCTAGTTGGTTGGGGGCATAGAATATATGTATCTTTGCAAGGTTCTATATGTTGAT

GCCTTCATCTTTTCATTTCTTTATTCCTATTTTCATGTGTTTCTGTTTCTTCCATTGTATTGGGGGTGGGGAGGAAAAACATATCAAAGCTAGAATGCAA

CATGTCCAGCATCCAGTTCTCTCATTTTAGAGGTTTAGAAGCTGAAGGTCAGAACGTCAGGTGACTTGGCCAGATTCACTTAACAAAAAAAATGACAGAG

CAAGAAATACAGCTTGCTTTTCTATTATGCAACTCTCTTATTATATTTGCATGTTATGTATGTATATAGATGTTTGCCTGGTCCTTTTTAATTTGAGATA

AAAATGTGACTTTTTCTTGGTATATATAGAATAAAAATGTATTTTCTGTTGTA
Translation
MAGLPVRDPAVDRSLRSVFV - UNI12490 - VGNIPYEATEEQLKDIFSEVGPVVSFR RLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFS

GRALRVDNAASEKNKEELKS SLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMK LCVQNSPQEARNMLLQNPQLAYALLQAQVVMR

IVDPEIAL KILHRQTNIPTLISGNPQPVHVAGPGSGPNVSMNQQNPQAPQAQSL GGMHVNGAPPMMQASMPGGVPAPVQMAAAVGGPGPGSLAPAG -

 UNI14813 - GVMQAQVGMQGAGPVPMERGQV VPMQDPRAAMQRGALPTNVPTPRGLLGDAPNDPRGGTLMTVTGDVEPR RAYLGPPPPPHQGPPM

HHVPGHEGRGPPPHDMRGGPLAEPRPLMAEPRGPMLDQRGPPLDARG GGRDPRGLDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAMEARA

MEARAMEARGMDTRGPVPGPRGPMPSGIQGPNPMNMGAVVPQGSRQVMLVAYT
Transcript ENSMUST00000113287
Sequence
CCCCGGGGCCGAGCCGCCTGGCGGGAACGACCGCGGTGAGGCGCGCGGCCGGGCTCCGCGGCGGCGCTTCGGGGCCAGGTGCTTCCGGCTCCCACCGGAC

GGAGGCGGGCTGGGCCGTGGTCTCGCTCGGCCGCGGAAGTGTGCTTTAGCGCACCGGAAGCCACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAG

ACCCTGCGGTGGATCGTTCCCTGCGCTCCGTCTTCG - UNI12490 - TGGGAAACATCCCTTATGAAGCTACTGAAGAACAACTGAAGGACATTTTC

TCTGAGGTTGGGCCTGTTGTTAGTTTCAG ATTGGTATACGATAGGGAGACAGGAAAACCAAAGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACA

GCACTTAGTGCCATGCGGAACTTGAATGGGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGATAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA

 GCCTTGGCACTGGTGCACCTGTCATAGAGTCACCTTATGGAGAAAGCATCAGCCCTGAGGATGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTC

CACCAGAACAGATGTTTGAGTTGATGAAACAAATGAAG CTCTGTGTCCAGAATAGTCCCCAGGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGG

CTTATGCTTTGTTGCAAGCACAGGTAGTGATGAGAATTGTGGATCCTGAGATTGCGCTG AAAATTCTGCATCGCCAGACAAATATCCCAACGCTGATTT

CAGGCAACCCTCAGCCAGTTCATGTTGCTGGGCCTGGCTCAGGACCCAATGTTTCAATGAACCAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG G

GTGGAATGCATGTCAATGGCGCACCTCCTATGATGCAAGCTTCTATGCCAGGTGGAGTTCCAGCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGG

CCCTGGTTCCTTAGCCCCTGCAG - UNI14813 - GAGTTATGCAAGCCCAAGTTGGAATGCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG

 GTGATGCTCCCAATGACCCGCGGGGAGGCACTTTAATGACTGTAACTGGAGACGTAGAACCTAG AGCTTACCTGGGACCACCACCACCACCTCATCAG

GGCCCACCCATGCACCATGTTCCTGGTCATGAAGGTCGTGGACCGCCTCCACATGACATGAGAGGAGGACCCCTAGCTGAGCCGAGACCTTTAATGGCAG

AACCAAGAGGACCCATGCTAGATCAGAGGGGCCCACCTCTGGATGCCAGAG GTGGAAGAGATCCCCGAGGATTAGATGCACGGGGGATGGAGGCCAGAG

CCATGGAAGCAAGAGGACTAGATGCCAGAGGACTGGAAGCCCGTGCCATGGAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAGCCCGTGCCATGGAAGC

CCGTGCCATGGAGGCTCGTGCCATGGAGGCCAGAGGCATGGACACCAGAGGCCCAGTACCTGGACCTAGAGGACCTATGCCTAGTGGAATCCAAGGTCCC

AATCCAATGAACATGGGGGCAGTTGTTCCCCAGGGATCCAGACAG GTACCAGTCATGCAGGGAGCAGGCATGCAAGGAGCAAGCATGCAAGGTGGAAGC

CAGCCTGGTGGCTTTAGTCCTGGACAGAGCCAAGTCACACCCCAGGATCATGAGAAG GCTGCTTTGATTATGCAGGTCCTTCAGCTCACTGCAGACCAG

ATCGCCATGCTGCCTCCTGAGCAAAGACAGAGTATCCTAATCTTAAAGGAACAGATACAGAAATCCACTGGGGCACCTTGAAAG - UNI20362 - GT

TCTCAAAATAGCTGGCAACAAATCTGGAAATGTAATTCCATAACATTTTTGAAATTTTGAAAACATAATGACGTCTGCATCCGAACCTCCCCGGATGAGG

CAGATGGCGCCAGGTGGAGGTCTTACATCGCCATTGCTCCAAAGGAAAGCAGTTTATTCTGTTGTCGTAGTGTGTATATTTTCTGTGACATTAAATAAAC

TTTGAACACAAGTTTAACATACTACAAATTGATATACATAATCCTTTTGCTTTTAAGAAGCTAACAGCAAGGATGTAAGCTTAACTGTGATTTCTAACTG

CAGCATCATTCTTTAATCTTACATTGCCATAGCTCTATTCTTACTTTAGCATAAGCATTTATTCTTCTTAATGATACTTGAGAATTTCTCAGAAACAATG

TTTTCAGGAACTTTGATTTTTGTTGAATTTGCTTTCAGTAAAGTAATAACACTTTACCCCGTGAAAACTTTCTAGAGTCTCAGAGCTTTCTGGGAGGAAA

ACAAAAAAGCACGTGGTTAGAACTAAAAATGATCAGAAGGCCAACAAGGGAAGAGCGTACCACAACAGTGTGTTTGCTTCCAGAAATGCCAGTTATCCAA

GTGTGTTGTTTGGTCAGTAGCAGGTGTGAACATACATAGGACAAAGGCTGTCGTGGCACTGGTTTGCAAAAGATTGTCGTAAAGCTCTCCTGTCTAGGTA

GCCCGCTTTACAAGTTTAAAAAGGCACTGGTTTTCCACATGGTCAAATTTAATAAAGAAAACCAAGTGAACAAAATATATTCCAATCTTTCAGAAAATCA

CAAAGCTTTCAGCCCTGTCATCTTAACTAAATCCATTCCAAGAACTTCAAACAGAAAACCCTAAAACTTTGACATTTTCAAGTCTTTAAAGAGGACCAAG

TATAGAGCACCGGACGGCAAACTGCCCGTTATGGTTGCCTGCTTCTTTCCAAGTCCGACCAACTTGGAAGGCAATTAGTGCCATTAGCCTGTGCTAACCT

GCAGGTTGCCTTGCCTTTTGTTCTCCCACAGTGGCATTAAGGAGGAACTTGGTTTCTCTCCACCAGTTTGACCTCAAGACATTTGAAGAGTTGCCTTAAT

AATTATTAAGTTTACTAGCACTAATTGTAAGCTTATTTGTATTCCCAGATCCCTACCCTCTGCATTAGGATTATGGGCAGGTGAATTAAAATCACTACTT

AAGGCATAAAAAGCATAGTAGTACATTGCTTATATGCCAAGAAAAAGAAAGCAAAGATATTAAAATTGAAGGATTTTTCTCCATATATTTTTAATGAAAA

TTTGCTGGATCTGTCATATTATAACCTGTCAAGAAAAGTATAAAACAACAAGCACTCCTGCCTGCCTATTCCACTCATGCCCAGTTCAACCCCGATGGAT

GTTAATTATGCATGCACTTCTTTGTCATTACCCTCTGTGCCTCCTGCAGAAGCAGTCCTTGCTGTGTTGGTTTTGGCAGCTGTCTTGACTTAAAAGCACC

AATGTATTTAGATGCAGAGACCAAGAGCAAAGTATTTCTAGTTAGGAACTTGGGTTTTACACAACCAGTTCCAAATCAAGATAAGTGAAGCTGAAGTGAT

TTGGGAAACAGTTGTCTAGTAGAAACCATGTCCTGGAAAGCCAGCACATTTTCCCGAAGCCTCAGTAAACTTAATTTGCTTAGCAGGCATTCAGGTGACT

AAGTTGACAAGAGCAGTGGCATCCCAATTCATCACTATGGAAACACTCATCAGTGGTTGGTTGGTTTGTTTGCTGTTATTTTTTACTGTTGTAATAATAC

AGTTAGCTACCCC
Translation
MAGLPVRDPAVDRSLRSVFV - UNI12490 - VGNIPYEATEEQLKDIFSEVGPVVSFR RLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFS

GRALRVDNAASEKNKEELKS SLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMK LCVQNSPQEARNMLLQNPQLAYALLQAQVVMR

IVDPEIAL KILHRQTNIPTLISGNPQPVHVAGPGSGPNVSMNQQNPQAPQAQSL GGMHVNGAPPMMQASMPGGVPAPVQMAAAVGGPGPGSLAPAG -

 UNI14813 - GVMQAQVGMQGAGPVPMERGQG GDAPNDPRGGTLMTVTGDVEPR RAYLGPPPPPHQGPPMHHVPGHEGRGPPPHDMRGGPLAEPRP

LMAEPRGPMLDQRGPPLDARG GGRDPRGLDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAMEARAMEARAMEARGMDTRGPVPGPRGPMPS

GIQGPNPMNMGAVVPQGSRQ VPVMQGAGMQGASMQGGSQPGGFSPGQSQVTPQDHEK AALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP 

- UNI20362 - 
Transcript ENSMUST00000033609
Sequence
ACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAGACCCTGCGGTGGATCGTTCCCTGCGCTCCGTCTTCG - UNI12490 - TGGGAAACATCC

CTTATGAAGCTACTGAAGAACAACTGAAGGACATTTTCTCTGAGGTTGGGCCTGTTGTTAGTTTCAG ATTGGTATACGATAGGGAGACAGGAAAACCAA

AGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACAGCACTTAGTGCCATGCGGAACTTGAATGGGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGA

TAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA GCCTTGGCACTGGTGCACCTGTCATAGAGTCACCTTATGGAGAAAGCATCAGCCCTGAGGA

TGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTCCACCAGAACAGATGTTTGAGTTGATGAAACAAATGAAG CTCTGTGTCCAGAATAGTCCCCA

GGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGGCTTATGCTTTGTTGCAAGCACAGGTAGTGATGAGAATTGTGGATCCTGAGATTGCGCTG AA

AATTCTGCATCGCCAGACAAATATCCCAACGCTGATTTCAGGCAACCCTCAGCCAGTTCATGTTGCTGGGCCTGGCTCAGGACCCAATGTTTCAATGAAC

CAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG GGTGGAATGCATGTCAATGGCGCACCTCCTATGATGCAAGCTTCTATGCCAGGTGGAGTTCCA

GCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGGCCCTGGTTCCTTAGCCCCTGCAG - UNI14813 - GAGTTATGCAAGCCCAAGTTGGAAT

GCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG TGCCAATGCAAGACCCCAGAGCAGCTATGCAGCGGGGAGCCTTGCCTACCAACGTCCCAAC

TCCTCGTGGTCTTTTAGGTGATGCTCCCAATGACCCGCGGGGAGGCACTTTAATGACTGTAACTGGAGACGTAGAACCTAG AGCTTACCTGGGACCACC

ACCACCACCTCATCAGGGCCCACCCATGCACCATGTTCCTGGTCATGAAGGTCGTGGACCGCCTCCACATGACATGAGAGGAGGACCCCTAGCTGAGCCG

AGACCTTTAATGGCAGAACCAAGAGGACCCATGCTAGATCAGAGGGGCCCACCTCTGGATGCCAGAG GTGGAAGAGATCCCCGAGGATTAGATGCACGG

GGGATGGAGGCCAGAGCCATGGAAGCAAGAGGACTAGATGCCAGAGGACTGGAAGCCCGTGCCATGGAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAG

CCCGTGCCATGGAAGCCCGTGCCATGGAGGCTCGTGCCATGGAGGCCAGAGGCATGGACACCAGAGGCCCAGTACCTGGACCTAGAGGACCTATGCCTAG

TGGAATCCAAGGTCCCAATCCAATGAACATGGGGGCAGTTGTTCCCCAGGGATCCAGACAG GTACCAGTCATGCAGGGAGCAGGCATGCAAGGAGCAAG

CATGCAAGGTGGAAGCCAGCCTGGTGGCTTTAGTCCTGGACAGAGCCAAGTCACACCCCAGGATCATGAGAAG GCTGCTTTGATTATGCAGGTCCTTCA

GCTCACTGCAGACCAGATCGCCATGCTGCCTCCTGAGCAAAGACAGAGTATCCTAATCTTAAAGGAACAGATACAGAAATCCACTGGGGCACCTTGAAAG

 - UNI20362 - GTTCTCAAAATAGCTGGCAACAAATCTGGAAATGTAATTCCATAACATTTTTGAAATTTTGAAAACATAATGACGTCTGCATCCGA

ACCTCCCCGGATGAGGCAGATGGCGCCAGGTGGAGGTCTTACATCGCCATTGCTCCAAAGGAAAGCAGTTTATTCTGTTGTCGTAGTGTGTATATTTTCT

GTGACATTAAATAAACTTTGAACACAAGTTTAACATACTACAAATTGATATACATAATCCTTTTGCTTTTAAGAAGCTAACAGCAAGGATGTAAGCTTAA

CTGTGATTTCTAACTGCAGCATCATTCTTTAATCTTACATTGCCATAGCTCTATTCTTACTTTAGCATAAGCATTTATTCTTCTTAATGATACTTGAGAA

TTTCTCAGAAACAATGTTTTCAGGAACTTTGATTTTTGTTGAATTTGCTTTCAGTAAAGTAATAACACTTTACCCCGTGAAAACTTTCTAGAGTCTCAGA

GCTTTCTGGGAGGAAAACAAAAAAGCACGTGGTTAGAACTAAAAATGATCAGAAGGCCAACAAGGGAAGAGCGTACCACAACAGTGTGTTTGCTTCCAGA

AATGCCAGTTATCCAAGTGTGTTGTTTGGTCAGTAGCAGGTGTGAACATACATAGGACAAAGGCTGTCGTGGCACTGGTTTGCAAAAGATTGTCGTAAAG

CTCTCCTGTCTAGGTAGCCCGCTTTACAAGTTTAAAAAGGCACTGGTTTTCCACATGGTCAAATTTAATAAAGAAAACCAAGTGAACAAAATATATTCCA

ATCTTTCAGAAAATCACAAAGCTTTCAGCCCTGTCATCTTAACTAAATCCATTCCAAGAACTTCAAACAGAAAACCCTAAAACTTTGACATTTTCAAGTC

TTTAAAGAGGACCAAGTATAGAGCACCGGACGGCAAACTGCCCGTTATGGTTGCCTGCTTCTTTCCAAGTCCGACCAACTTGGAAGGCAATTAGTGCCAT

TAGCCTGTGCTAACCTGCAGGTTGCCTTGCCTTTTGTTCTCCCACAGTGGCATTAAGGAGGAACTTGGTTTCTCTCCACCAGTTTGACCTCAAGACATTT

GAAGAGTTGCCTTAATAATTATTAAGTTTACTAGCACTAATTGTAAGCTTATTTGTATTCCCAGATCCCTACCCTCTGCATTAGGATTATGGGCAGGTGA

ATTAAAATCACTACTTAAGGCATAAAAAGCATAGTAGTACATTGCTTATATGCCAAGAAAAAGAAAGCAAAGATATTAAAATTGAAGGATTTTTCTCCAT

ATATTTTTAATGAAAATTTGCTGGATCTGTCATATTATAACCTGTCAAGAAAAGTATAAAACAACAAGCACTCCTGCCTGCCTATTCCACTCATGCCCAG

TTCAACCCCGATGGATGTTAATTATGCATGCACTTCTTTGTCATTACCCTCTGTGCCTCCTGCAGAAGCAGTCCTTGCTGTGTTGGTTTTGGCAGCTGTC

TTGACTTAAAAGCACCAATGTATTTAGATGCAGAGACCAAGAGCAAAGTATTTCTAGTTAGGAACTTGGGTTTTACACAACCAGTTCCAAATCAAGATAA

GTGAAGCTGAAGTGATTTGGGAAACAGTTGTCTAGTAGAAACCATGTCCTGGAAAGCCAGCACATTTTCCCGAAGCCTCAGTAAACTTAATTTGCTTAGC

AGGCATTCAGGTGACTAAGTTGACAAGAGCAGTGGCATCCCAATTCATCACTATGGAAACACTCATCAGTGGTTGGTTGGTTTGTTTGCTGTTATTTTTT

ACTGTTGTAATAATACAGTTAGCTACCCCACGTTCATGATCTGCCTTTATTATGTTCAAAACTAATGACTGAAAAATAATCCCACAAATCCTTCAGGCTG

TAAGTTCCTAGATAATTGAAAACAAAAATGTGTTCACTTTTGGTTAATTAATGGTACAAATTAGATGGTCTAGTGCTAACTCTATAGATTCATTCTGCTA

AATGTATGAGGTCAACTGCCTGAGTACAGTGAAGTGTGGAGTTTTTTCTCCCTGAAGAGCCTGCACCTTTTTGTGTAATTCACCATAACTAACATCCCAG

AGCCAGCGTGCTTATTGTCCTGGTTGATAGGAAAAATCAACATTTTTGTAGGAAAAAGAGTGACATTTAGTGGATGATTCCTGATTGAGTAAGACCTGGA

AAATAGCCAAAATTATAACTTTTTTCTTTTTATAATACATTCATTAACAAACTCCTTTAACAACAACAAAAAGCATAAAAGAGCTTCAGTTCAATTATCT

CATGATGTACGTCAGGCCTTTCCAGTTATTCCAAACAATACAAAGTGACAATATAGTTGGCTTCTAACTATAGTACAAATTTGATTACAGTTAATATACT

TAAGATATTACTAGGAAATTGTTCAATAAGCAAAAAGGAAAGTCAATTATTTTGACAAAGTAACGTGTAAATTGTTGGTCACACTGGATTAACTCATGTA

ACAATGTACTTAGTGGGTGATATGGGAGTGGGAAGCTTGGTCGTTCTATGTTGTTTATTTATGATTGTTGTTCTGTCGTGGATTCAATAAATATTTTAAA

AGTC
Translation
MAGLPVRDPAVDRSLRSVFV - UNI12490 - VGNIPYEATEEQLKDIFSEVGPVVSFR RLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFS

GRALRVDNAASEKNKEELKS SLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMK LCVQNSPQEARNMLLQNPQLAYALLQAQVVMR

IVDPEIAL KILHRQTNIPTLISGNPQPVHVAGPGSGPNVSMNQQNPQAPQAQSL GGMHVNGAPPMMQASMPGGVPAPVQMAAAVGGPGPGSLAPAG -

 UNI14813 - GVMQAQVGMQGAGPVPMERGQV VPMQDPRAAMQRGALPTNVPTPRGLLGDAPNDPRGGTLMTVTGDVEPR RAYLGPPPPPHQGPPM

HHVPGHEGRGPPPHDMRGGPLAEPRPLMAEPRGPMLDQRGPPLDARG GGRDPRGLDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAMEARA

MEARAMEARGMDTRGPVPGPRGPMPSGIQGPNPMNMGAVVPQGSRQ VPVMQGAGMQGASMQGGSQPGGFSPGQSQVTPQDHEK AALIMQVLQLTADQI

AMLPPEQRQSILILKEQIQKSTGAP - UNI20362 - 
Transcript ENSMUST00000113291
Sequence
AGCGCACCGGAAGCCACCTCGGGGGTGAGCCATGGCGGGTTTGCCAGTGAGAGACCCTGCGGTGGATCGTTCCCTGCGCTCCGTCTTCG - UNI12490

 - ATTGGTATACGATAGGGAGACAGGAAAACCAAAGGGCTATGGCTTCTGCGAGTACCAAGACCAAGAGACAGCACTTAGTGCCATGCGGAACTTGAAT

GGGCGTGAATTCAGCGGGAGAGCACTTCGAGTGGATAATGCTGCCAGTGAAAAGAACAAGGAGGAACTGAAGA GCCTTGGCACTGGTGCACCTGTCATA

GAGTCACCTTATGGAGAAAGCATCAGCCCTGAGGATGCCCCTGAATCCATTAGCAAAGCAGTTGCCAGTCTTCCACCAGAACAGATGTTTGAGTTGATGA

AACAAATGAAG CTCTGTGTCCAGAATAGTCCCCAGGAAGCACGAAACATGTTGCTTCAGAATCCACAGCTGGCTTATGCTTTGTTGCAAGCACAGGTAG

TGATGAGAATTGTGGATCCTGAGATTGCGCTG AAAATTCTGCATCGCCAGACAAATATCCCAACGCTGATTTCAGGCAACCCTCAGCCAGTTCATGTTG

CTGGGCCTGGCTCAGGACCCAATGTTTCAATGAACCAGCAGAATCCGCAGGCCCCTCAGGCTCAATCTTTG GGTGGAATGCATGTCAATGGCGCACCTC

CTATGATGCAAGCTTCTATGCCAGGTGGAGTTCCAGCCCCAGTGCAGATGGCAGCTGCTGTAGGAGGACCTGGCCCTGGTTCCTTAGCCCCTGCAG - U

NI14813 - GAGTTATGCAAGCCCAAGTTGGAATGCAAGGAGCTGGACCAGTGCCCATGGAACGAGGACAAG TGCCAATGCAAGACCCCAGAGCAGCT

ATGCAGCGGGGAGCCTTGCCTACCAACGTCCCAACTCCTCGTGGTCTTTTAGGTGATGCTCCCAATGACCCGCGGGGAGGCACTTTAATGACTGTAACTG

GAGACGTAGAACCTAG AGCTTACCTGGGACCACCACCACCACCTCATCAGGGCCCACCCATGCACCATGTTCCTGGTCATGAAGGTCGTGGACCGCCTC

CACATGACATGAGAGGAGGACCCCTAGCTGAGCCGAGACCTTTAATGGCAGAACCAAGAGGACCCATGCTAGATCAGAGGGGCCCACCTCTGGATGCCAG

AG GTGGAAGAGATCCCCGAGGATTAGATGCACGGGGGATGGAGGCCAGAGCCATGGAAGCAAGAGGACTAGATGCCAGAGGACTGGAAGCCCGTGCCAT

GGAGGCCCGTGCCATGGAGGCCCGTGCCATGGAAGCCCGTGCCATGGAAGCCCGTGCCATGGAGGCTCGTGCCATGGAGGCCAGAGGCATGGACACCAGA

GGCCCAGTACCTGGACCTAGAGGACCTATGCCTAGTGGAATCCAAGGTCCCAATCCAATGAACATGGGGGCAGTTGTTCCCCAGGGATCCAGACAG GTA

CCAGTCATGCAGGGAGCAGGCATGCAAGGAGCAAGCATGCAAGGTGGAAGCCAGCCTGGTGGCTTTAGTCCTGGACAGAGCCAAGTCACACCCCAGGATC

ATGAGAAG GCTGCTTTGATTATGCAGGTCCTTCAGCTCACTGCAGACCAGATCGCCATGCTGCCTCCTGAGCAAAGACAGAGTATCCTAATCTTAAAGG

AACAGATACAGAAATCCACTGGGGCACCTTGAAAG - UNI20362 - GTTCTCAAAATAGCTGGCAACAAATCTGGAAATGTAATTCCATAACATTTT

TGAAATTTTGAAAACATAATGACGTCTGCATCCGAACCTCCCCGGATGAGGCAGATGGCGCCAGGTGGAGGTCTTACATCGCCATTGCTCCAAAGGAAAG

CAGTTTATTCTGTTGTCGTAGTGTGTATATTTTCTGTGACATTAAATAAACTTTGAACACAAGTTTAACATACTACAAATTGATATACATAATCCTTTTG

CTTTTAAGAAGCTAACAGCAAGGATGTAAGCTTAACTGTGATTTCTAACTGCAGCATCATTCTTTAATCTTACATTGCCATAGCTCTATTCTTACTTTAG

CATAAGCATTTATTCTTCTTAATGATACTTGAGAATTTCTCAGAAACAATGTTTTCAGGAACTTTGATTTTTGTTGAATTTGCTTTCAGTAAAGTAATAA

CACTTTACCCCGTGAAAACTTTCTAGAGTCTCAGAGCTTTCTGGGAGGAAAACAAAAAAGCACGTGGTTAGAACTAAAAATGATCAGAAGGCCAACAAGG

GAAGAGCGTACCACAACAGTGTGTTTGCTTCCAGAAATGCCAGTTATCCAAGTGTGTTGTTTGGTCAGTAGCAGGTGTGAACATACATAGGACAAAGGCT

GTCGTGGCACTGGTTTGCAAAAGATTGTCGTAAAGCTCTCCTGTCTAGGTAGCCCGCTTTACAAGTTTAAAAAGGCACTGGTTTTCCACATGGTCAAATT

TAATAAAGAAAACCAAGTGAACAAAATATATTCCAATCTTTCAGAAAATCACAAAGCTTTCAGCCCTGTCATCTTAACTAAATCCATTCCAAGAACTTCA

AACAGAAAACCCTAAAACTTTGACATTTTCAAGTCTTTAAAGAGGACCAAGTATAGAGCACCGGACGGCAAACTGCCCGTTATGGTTGCCTGCTTCTTTC

CAAGTCCGACCAACTTGGAAGGCAATTAGTGCCATTAGCCTGTGCTAACCTGCAGGTTGCCTTGCCTTTTGTTCTCCCACAGTGGCATTAAGGAGGAACT

TGGTTTCTCTCCACCAGTTTGACCTCAAGACATTTGAAGAGTTGCCTTAATAATTATTAAGTTTACTAGCACTAATTGTAAGCTTATTTGTATTCCCAGA

TCCCTACCCTCTGCATTAGGATTATGGGCAGGTGAATTAAAATCACTACTTAAGGCATAAAAAGCATAGTAGTACATTGCTTATATGCCAAGAAAAAGAA

AGCAAAGATATTAAAATTGAAGGATTTTTCTCCATATATTTTTAATGAAAATTTGCTGGATCTGTCATATTATAACCTGTCAAGAAAAGTATAAAACAAC

AAGCACTCCTGCCTGCCTATTCCACTCATGCCCAGTTCAACCCCGATGGATGTTAATTATGCATGCACTTCTTTGTCATTACCCTCTGTGCCTCCTGCAG

AAGCAGTCCTTGCTGTGTTGGTTTTGGCAGCTGTCTTGACTTAAAAGCACCAATGTATTTAGATGCAGAGACCAAGAGCAAAGTATTTCTAGTTAGGAAC

TTGGGTTTTACACAACCAGTTCCAAATCAAGATAAGTGAAGCTGAAGTGATTTGGGAAACAGTTGTCTAGTAGAAACCATGTCCTGGAAAGCCAGCACAT

TTTCCCGAAGCCTCAGTAAACTTAATTTGCTTAGCAGGCATTCAGGTGACTAAGTTGACAAGAGCAGTGGCATCCCAATTCATCACTATGGAAACACTCA

TCAGTGGTTGGTTGGTTTGTTTGCTGTTATTTTTTACTGTTGTAATAATACAGTTAGCTACCCCACGTTCATGATCTGCCTTTATTATGTTCAAAACTAA

TGACTGAAAAATAATCCCACAAATCCTTCAGGCTGTAAGTTCCTAGATAATTGAAAACAAAAATGTGTTCACTTTTGGTTAATTAATGGTACAAATTAGA

TGGTCTAGTGCTAACTCTATAGATTCATTCTGCTAAATGTATGAGGTCAACTGCCTGAGTACAGTGAAGTGTGGAGTTTTTTCTCCCTGAAGAGCCTGCA

CCTTTTTGTGTAATTCACCATAACTAACATCCCAGAGCCAGCGTGCTTATTGTCCTGGTTGATAGGAAAAATCAACATTTTTGTAGGAAAAAGAGTGACA

TTTAGTGGATGATTCCTGATTGAGTAAGACCTGGAAAATAGCCAAAATTATAACTTTTTTCTTTTTATAATACATTCATTAACAAACTCCTTTAACAACA

ACAAAAAGCATAAAAGAGCTTCAGTTCAATTATCTCATGATGTACGTCAGGCCTTTCCAGTTATTCCAAACAATACAAAGTGACAATATAGTTGGCTTCT

AACTATAGTACAAATTTGATTACAGTTAATATACTTAAGATATTACTAGGAAATTGTTCAATAAGCAAAAAGGAAAGTCAATTATTTTGACAAAGTAACG

TGTAAATTGTTGGTCACACTGGATTAACTCATGTAACAATGTACTTAGTGGGTGATATGGGAGTGGGAAGCTTGGTCGTTCTATGTTGTTTATTTATGAT

TGTTGTTCTGTCGTGGATTCAATAAATATTTTAAAAGTC
Translation
SAPEATSGVSHGGFASERPCGGSFPALRLR - UNI12490 - RLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEEL

KS SLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMK LCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIAL KILHRQTNI

PTL  - UNI14813 -       - UNI20362 - 

For any suggestions or comments, please send an email to unitrap@crg.es