Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031258 (Xkrx)
Chromosomal location
Chr X: 130683584 - 130696467 (-)
Description
X Kell blood group precursor related X linked Gene [Source:MGI (curated);Acc:Xkrx-001]
RefSeq_dna
NM_183319 
RefSeq_peptide
NP_899142.2 
UniGene
Mm.235055 
MGI
MGI:3584011 
Uniprot/SWISSPROT
Q5GH68 
Uniprot/SPTREMBL
A2AEK6 Q8C9P4 
Human Ortholog
ENSG00000182489 (XKRX)
Omim not available
UniTrap UNI22932
Vector Insertion
Chr X: 130692021 - 130696114
Public Clones not available
Private Clones OST280939 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033611
Sequence
AGTAAGAGAGTCTCAACAATGGACAGAGTTTATGAAATTCCTGAGGAGCCAAATGTGGTTCCCATTTCATCTCTGGAAGAAGATGTCATCCGGGGGCCTA

ACCCACGCTTTACCTTCCCGTTTAGTATCCTCTTCTCCACCTTTTTGTACTGTGGGGAGGCTGCGTCTGCTTTGTACATGGTTAGAATTTACCGAAAGAA

TAATGAAACCTTCTGGATGACATACACATTTTCCTTTTTCATGTTTTCATCTATCATGGTTCAGTTGACCCTCATTTTTGTCCACAGAGACCTGGCCAAA

GATAGACCACTATCATTATTTATGCATCTAATCCTCTTGGGACCTGTTATCAG - UNI22932 - ATGTTTGGAGGCCATGATTAAATACCTTACACT

GTGGAAGAAAGAGGGGCAGGAGGAGCCATATGTCAGCCTCACCCGAAAGAAGATGCTAATAGCTGGCCAGGAGGTGCTGATAGAATGGGAGGTGGGCCAC

TCCATCCGGACCCTGGCTATGCATCGCAATGCCTACAAACGTATGTCACAGATTCAAGCCTTCCTGGGCTCAGTGCCCCAGCTGACCTATCAGCTATATG

TGAGTCTGATCTCAGCAGAAGTCCCCCTGGGTAGAG CTGTGTTAATGGCTTTTTCCCTGATATCTGTCACCTACGGGGCTACCCTGTGCAATATGTTGG

CTATCCAGATCAAGTATGATGACTACAAGATTAGACTGGGGCCACTGGAAGTCCTTTGTATCACCGTCTGGAGGACATTGGAGATCACTTCCCGCCTCGT

GATTCTGGTGCTCTTCTCGGCCACCTTGAAGTTGAAGGCTGTGCCCTTCTTAGTGCTCAACTTCTTGATCATCCTCTTTGAGCCCTGGGTCAAGTTCTGG

AGGAGTGGTGCCCAAATGCCAAACAATATTGAGAAAAACTTCAGCCGAGTTGGCACTCTGGTGGTACTGATTTCGGTCACCATTCTCTATGCTGGCATCA

ACTTCTCTTGCTGGTCAGCCATGCAGTTGAAGTTGGCAGACAGAGACCTTGTTGACAAAGGTCAGAACTGGGGACATATGGGACTGCACTATAGTGTGAG

GCTGGTAGAGAATGTGATCATGGTCTTGGTTTTTAAGTACTTCGGAGTCAAAGTGTTACTGAATTATTGTCATTCCTTGATTGCAGTGCAGCTTATTATT

GCTTATCTGATTTCCATTGGGGTCATGCTTCTCTTCTTCCAGTACTTGCACCCCCTGCGCTCACTCTTCACCAATAACGTAGTAGACTACCTCCATTGTA

TCTGCTGCCGCAGACCCCGTCCGGAAAGGGTTGAGAACTCAGAGACATCCTGTGAAGCTGACACAACACAAAGTATTGTCTGATTTTTTTTTTCTTCTGT

ACATTATAGGATGGGTCTGGGTTAACACAAGCAACTGTGAAATTGAAGGAGTTGGTGAGATCCCTGTGTGTGAGTACTCACAGGATCATTTGCTTGACAC

TTCTAGTAAACCTATTGAAAGAAAGAGTGACCTGCAAAGAGGTTTTACTTCTTTAGGATTGACTGCTAGGTTTGGATACCAGCACTAACCCTAACCCTAG

CCCTAGCCCTAGCCCTAACCCTAACCCTAGCCCTAACCCTAACCCTAACCCTAGCCCTAACCCTAGCCCTAACCCTAACCCTAGCCCTAACCCTAGCCCT

AACGCTAACCCTAGCCCTAGCCCTAACCCTAGCCCTAACGCTAACCCTAGCCCTAGCCCTAACCCTAGCTCTAATGCTAACCCTAGCCCTAACGCTAACC

CTAGCCCTAGCCCTAGCCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTAACCCTGGAATAACCTCTATGTCCTTCACTCA

GGCTCTGAATTTCCAGCTTTGCTCATTTGCTTAAGGTATTGCTGAGCTTCCCTGGGCTAATCTAAACTCTGCCAGAACTCAACTGTACTGATCAGGGAAT

GTGATGGCTTACTAAGAATGAGCGCCTTCCAGAAAGTAGTCTGACTGTTGTACTTTTTGTTTTGTTTTGATTTAGGTTTTTATTTGAGACAGGGTTTCTC

TGTGTAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTCAAACTCAGAAATCCACCTTCCTCTTCCTCCCAAGTGCTGAGATTAAAGGC

ATGCGCCACCACCGCCTGGCTGGCTGTTGTACTTTTAACTGTGAGAGTGGCTGGGATATTTGTATTCTAATGAGGAACTGTGGCTAAGAAGAAGGCTCCA

TTATTGAAGAAAGCTACTCCCCAAATGAGTTAATACCCCATGAGTATTTTACTGGGGGTCATTCAGCAAAGACTTCTCCTTTAAGAAATCCTTCATAGGC

ACTCTCTTTGGACGGCGTACAGAATAAGATTCCTTCCTATAGGGAATGAGGCGGGATCTCATGACTCTCGGACTGGGCTCAACGTCACTATGTAGCTAAG

AACTACGTGGCCTGATCTTTCTGCCTTTACCTTCTGTGTGCTGGAATTGCAGATGCGTACCACTGCATTTGGTTTATATAATGCTGAGGACTGAACCCAG

GGCTAGGCAAGCACTATTTATACAGTACTAGGCCCTGGAACTGGGGTCAGGTAAACACTCTACCAACTGAGACATCCTTGGCCCCCAGAATGCCTCTTAA

GGACCTGTGTAGGCCTCCAGCCTCATTGAGAGAAATGTTTGAATGAAATTTCGGGTGCCCCATTAGAGGAATTCCCTCCAATTCAGCTTTTCTGTCTCTG

CCTTTTGTTACTTGATGTAAACCTCAGAGAAGCTAAACTGTAATTTGAAGTGTTTACTGATATGTGAAATAAATGAAGATTTCTTTGTG
Translation
MDRVYEIPEEPNVVPISSLEEDVIRGPNPRFTFPFSILFSTFLYCGEAASALYMVRIYRKNNETFWMTYTFSFFMFSSIMVQLTLIFVHRDLAKDRPLSL

FMHLILLGPVIR - UNI22932 - RCLEAMIKYLTLWKKEGQEEPYVSLTRKKMLIAGQEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLT

YQLYVSLISAEVPLGRA AVLMAFSLISVTYGATLCNMLAIQIKYDDYKIRLGPLEVLCITVWRTLEITSRLVILVLFSATLKLKAVPFLVLNFLIILFE

PWVKFWRSGAQMPNNIEKNFSRVGTLVVLISVTILYAGINFSCWSAMQLKLADRDLVDKGQNWGHMGLHYSVRLVENVIMVLVFKYFGVKVLLNYCHSLI

AVQLIIAYLISIGVMLLFFQYLHPLRSLFTNNVVDYLHCICCRRPRPERVENSETSCEADTTQSIV

For any suggestions or comments, please send an email to unitrap@crg.es