Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031264 (Btk)
Chromosomal location
Chr X: 131076909 - 131117667 (-)
Description
Bruton agammaglobulinemia tyrosine kinase Gene [Source:MGI (curated);Acc:Btk-002]
RefSeq_dna
NM_013482 
RefSeq_peptide
NP_038510.2 
UniGene
Mm.4475 
MGI
MGI:88216 
Uniprot/SWISSPROT
P35991 
Uniprot/SPTREMBL
A2BDW0 A2BDV9 Q7TMU1 
Human Ortholog
ENSG00000010671 (BTK)
Omim 307200 - HYPOGAMMAGLOBULINEMIA AND ISOLATED GROWTH HORMONE DEFICIENCY, X-LINKED  
UniTrap UNI15770
Vector Insertion
Chr X: 131117549 - 131117656
Public Clones not available
Private Clones OST500471 (lexicon) OST473245 (lexicon) OST473237 (lexicon) OST473221 (lexicon)
OST473218 (lexicon) OST473207 (lexicon) OST472728 (lexicon) OST472638 (lexicon)
OST472603 (lexicon) OST472232 (lexicon) OST471965 (lexicon) OST471940 (lexicon)
OST471924 (lexicon) OST471904 (lexicon) OST471867 (lexicon) OST471856 (lexicon)
OST471840 (lexicon) OST471837 (lexicon) OST471828 (lexicon) OST471824 (lexicon)
OST471744 (lexicon) OST471724 (lexicon) OST471716 (lexicon) OST471678 (lexicon)
OST471631 (lexicon) OST471354 (lexicon) OST471353 (lexicon) OST471327 (lexicon)
OST471190 (lexicon) OST471136 (lexicon) OST470993 (lexicon) OST470940 (lexicon)
OST470894 (lexicon) OST470861 (lexicon) OST470821 (lexicon) OST470791 (lexicon)
OST470518 (lexicon) OST470353 (lexicon) OST470276 (lexicon) OST470194 (lexicon)
OST469928 (lexicon) OST469401 (lexicon) OST469400 (lexicon) OST469273 (lexicon)
OST468723 (lexicon) OST468079 (lexicon) OST467944 (lexicon) OST467847 (lexicon)
OST467835 (lexicon) OST467829 (lexicon) OST467825 (lexicon) OST467814 (lexicon)
OST467806 (lexicon) OST467791 (lexicon) OST467774 (lexicon) OST467761 (lexicon)
OST467740 (lexicon) OST467677 (lexicon) OST467430 (lexicon) OST467413 (lexicon)
OST467177 (lexicon) OST467175 (lexicon) OST467159 (lexicon) OST467109 (lexicon)
OST467094 (lexicon) OST466916 (lexicon) OST466901 (lexicon) OST466870 (lexicon)
OST466786 (lexicon) OST466781 (lexicon) OST466427 (lexicon) OST466375 (lexicon)
OST466317 (lexicon) OST466286 (lexicon) OST466276 (lexicon) OST466072 (lexicon)
OST466069 (lexicon) OST465885 (lexicon) OST465772 (lexicon) OST465751 (lexicon)
OST465710 (lexicon) OST465585 (lexicon) OST465565 (lexicon) OST465464 (lexicon)
OST465343 (lexicon) OST465342 (lexicon) OST465310 (lexicon) OST465263 (lexicon)
OST465254 (lexicon) OST465147 (lexicon) OST465134 (lexicon) OST465133 (lexicon)
OST465031 (lexicon) OST464847 (lexicon) OST464805 (lexicon) OST464713 (lexicon)
OST464707 (lexicon) OST464678 (lexicon) OST464574 (lexicon) OST464502 (lexicon)
OST464479 (lexicon) OST464463 (lexicon) OST464432 (lexicon) OST464431 (lexicon)
OST464423 (lexicon) OST464401 (lexicon) OST464377 (lexicon) OST464355 (lexicon)
OST464350 (lexicon) OST464349 (lexicon) OST464297 (lexicon) OST464292 (lexicon)
OST464254 (lexicon) OST463981 (lexicon) OST463786 (lexicon) OST463143 (lexicon)
OST463082 (lexicon) OST462847 (lexicon) OST462710 (lexicon) OST462543 (lexicon)
OST462370 (lexicon) OST462210 (lexicon) OST461804 (lexicon) OST461686 (lexicon)
OST461622 (lexicon) OST461499 (lexicon) OST461393 (lexicon) OST461207 (lexicon)
OST461151 (lexicon) OST461130 (lexicon) OST461058 (lexicon) OST461025 (lexicon)
OST460823 (lexicon) OST460773 (lexicon) OST460188 (lexicon) OST460141 (lexicon)
OST459845 (lexicon) OST459519 (lexicon) OST459494 (lexicon) OST459462 (lexicon)
OST459252 (lexicon) OST459239 (lexicon) OST459084 (lexicon) OST459054 (lexicon)
OST458964 (lexicon) OST458791 (lexicon) OST458637 (lexicon) OST458503 (lexicon)
OST458491 (lexicon) OST458215 (lexicon) OST458174 (lexicon) OST457840 (lexicon)
OST457746 (lexicon) OST457740 (lexicon) OST457379 (lexicon) OST457314 (lexicon)
OST457074 (lexicon) OST456897 (lexicon) OST456785 (lexicon) OST456726 (lexicon)
OST456701 (lexicon) OST456648 (lexicon) OST456636 (lexicon) OST456620 (lexicon)
OST174168 (lexicon) OST174142 (lexicon) OST174117 (lexicon) OST174044 (lexicon)
OST173973 (lexicon) OST173766 (lexicon) OST173675 (lexicon) OST173642 (lexicon)
OST173625 (lexicon) OST173614 (lexicon) OST173396 (lexicon) OST173395 (lexicon)
OST173356 (lexicon) OST173344 (lexicon) OST172891 (lexicon) OST172871 (lexicon)
OST172851 (lexicon) OST172639 (lexicon) OST172511 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16967
Vector Insertion
Chr X: 131108627 - 131112008
Public Clones not available
Private Clones OST451684 (lexicon) OST350893 (lexicon) OST314491 (lexicon) OST302017 (lexicon)
OST290802 (lexicon) OST235461 (lexicon) OST232108 (lexicon) OST232064 (lexicon)
OST222514 (lexicon) OST218802 (lexicon) OST217826 (lexicon) OST217750 (lexicon)
OST216914 (lexicon) OST207229 (lexicon) OST195735 (lexicon) OST170025 (lexicon)
OST164126 (lexicon) OST164108 (lexicon) OST163877 (lexicon) OST163515 (lexicon)
OST163367 (lexicon) OST163361 (lexicon) OST163158 (lexicon) OST162758 (lexicon)
OST162021 (lexicon) OST161900 (lexicon) OST161716 (lexicon) OST161547 (lexicon)
OST161327 (lexicon) OST160978 (lexicon) OST160913 (lexicon) OST160840 (lexicon)
OST159506 (lexicon) OST159423 (lexicon) OST159114 (lexicon) OST158993 (lexicon)
OST158976 (lexicon) OST158942 (lexicon) OST158092 (lexicon) OST157825 (lexicon)
OST156986 (lexicon) OST155600 (lexicon) OST154959 (lexicon) OST153918 (lexicon)
OST153383 (lexicon) OST146268 (lexicon) OST142632 (lexicon) OST83335 (lexicon)
OST60507 (lexicon) OST59328 (lexicon) OST55575 (lexicon) OST49057 (lexicon)
OST46238 (lexicon) OST45645 (lexicon) OST45594 (lexicon) OST45164 (lexicon)
OST40474 (lexicon) OST38894 (lexicon) OST38001 (lexicon) OST37974 (lexicon)
OST37711 (lexicon) OST37267 (lexicon) OST37037 (lexicon) OST37015 (lexicon)
OST35541 (lexicon) OST35520 (lexicon) OST35512 (lexicon) OST35511 (lexicon)
OST35479 (lexicon) OST34718 (lexicon) OST34468 (lexicon) OST34453 (lexicon)
OST34427 (lexicon) OST34407 (lexicon) OST32801 (lexicon) OST32521 (lexicon)
OST31157 (lexicon) OST30835 (lexicon) OST30834 (lexicon) OST30705 (lexicon)
OST30525 (lexicon) OST30236 (lexicon) OST29706 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23748
Vector Insertion
Chr X: 131107847 - 131108455
Public Clones not available
Private Clones OST246172 (lexicon) OST208854 (lexicon) OST173473 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21615
Vector Insertion
Chr X: 131103513 - 131107747
Public Clones not available
Private Clones OST323884 (lexicon) OST290587 (lexicon) OST259481 (lexicon) OST240388 (lexicon)
OST222523 (lexicon) OST217969 (lexicon) OST216767 (lexicon) OST210329 (lexicon)
OST163628 (lexicon) OST161214 (lexicon) OST159016 (lexicon) OST158957 (lexicon)
OST158861 (lexicon) OST156397 (lexicon) OST156387 (lexicon) OST142650 (lexicon)
OST79654 (lexicon) OST77130 (lexicon) OST34741 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22994
Vector Insertion
Chr X: 131100218 - 131103443
Public Clones not available
Private Clones OST279458 (lexicon) OST187504 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27140
Vector Insertion
Chr X: 131093294 - 131093736
Public Clones not available
Private Clones OST68750 (lexicon)
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29129
Vector Insertion
Chr X: 131076913 - 131077347
Public Clones not available
Private Clones OST7607 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37393
Vector Insertion
Chr X: 131076908 - 131080179
Public Clones PST22185-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113213
Sequence
CTCTCTGGACTGTAAGAATATGTCTCCAGGTCCAGAGTCTTCAGAGATCAAGTCCCACCTTCCAAGTCCTGGCATCTCACGACGTCTGGGGAGCTACCTG

CATTAAGTCAGAACTGAG - UNI15770 - AAGAGCTGCACTGTGCCAGCCTTCTGGAAGACACTGAGATAGATGCTTCTTCTCTTATATTATTGGCT

AGTAGACCTAAGGAAGAGCTACCATATTTTTAGGTTGTATGAGTCTGGATTGCATCCTAAGGAAAGGAAGAAGAACAAAGGGATAGC - UNI16967 -

 TACACAAACAAGTTCCAGAGAGAGGAAGCCATGGCTGCAGTGATACTGGAGAGCATCTTTCTGAAGCGCTCCCAGCAGAAAAAGAAAACATCACCTTTA

AACTTCAAGAAGCGCCTGTTTCTCTTGACTGTACACAAACTTTCATACTATGAATATGACTTTGAACGTGGG - UNI23748 - AGAAGAGGCAGTAA

GAAAGGTTCAATAGATGTTGAGAAGATCACCTGTGTTGAAACAGTAATTCCTGAAAAAAATCCCCCACCAGAAAGACAGATTCCG - UNI21615 - A

GGAGAGGTGAGGAGTCTAGTGAAATGGAACAGATTTCAATCATTGAAAGGTTCCCGTACCCATTCCAG - UNI22994 - GTTGTATATGATGAAGGA

CCTCTCTATGTTTTCTCCCCAACTGAAGAGCTGAGAAAGCGCTGGATTCACCAGCTCAAAAATG TAATCCGGTACAATAGTGACCTGGTACAGAAATAC

CATCCTTGCTTCTGGATTGATGGACAGTATCTCTGCTGCTCTCAGACAGCCAAGAATGCTATGGGCTGCCAAATTTTGGAGAACAGGAATGGAA - UNI

27140 - GCTTAAAACCTGGGAGTTCTCATCGAAAAACGAAAAAGCCTCTTCCCCCTACCCCAGAGGAAGATCAG ATCTTGAAAAAACCGCTTCCCCC

GGAGCCAACAGCAGCACCAATCTCCACAACCGAGCTGAAAAAGGTCGTGGCCCTTTATGATTACATGCCAATGAACGCAAATGACTTACAATTGCGAAAG

GGCGAGGAGTATTTTATCCTGGAGGAGAGCAACCTACCGTGGTGGCGAGCACGAGATAAAAATGG GCAGGAAGGCTACATCCCAAGTAACTATATCACT

GAAGCTGAGGACTCCATAGAGATGTATGA GTGGTATTCCAAGCACATGACTCGAAGTCAAGCTGAGCAACTGCTAAAGCAAGAG GGGAAAGAAGGAGG

TTTCATTGTCAGAGACTCCAGCAAAGCTGGAAAATACACCGTGTCTGTGTTTGCTAAATCTACTGG GGAGCCTCAAGGGGTGATCCGCCATTACGTTGT

GTGTTCCACGCCACAGAGCCAGTATTACCTG GCAGCTCGAAACTGTTTGGTAAACGATCAAGGAGTTGTGAAAGTATCTGACTTTGGCCTGTCTAG GT

ATGTCCTTGATGATGAGTACACCAGCTCTGTAGGCTCCAAGTTTCCAGTCCGGTGGTCTCCACCAGAAGTGCTTATGTATAGCAAGTTCAGCAGCAAATC

TGACATCTGGGCTTTTG - UNI37393 - GGGTTTTAATGTGGGAGATCTACTCCCTGGGGAAGATGCCGTATGAGAGATTTACTAACAGTGAGACAG

CAGAACACATTGCTCAAGGCTTACGTCTCTACAGGCCTCATCTGGCATCAGAGAGGGTATATACCATCATGTACAGCTGCTGGCACGAG - UNI29129

 - - UNI37393 - AAAGCAGATGAACGTCCTAGTTTCAAAATTCTCTTGAGTAACATTCTAGATGTGATGGATGAAGAATCCTGAGCTGGCTGCTAA

GCTCCGTGGATCTCCTCCTCTCTCCTACAAAACCTAATTCCATGTTTCCTGAGGAGTTCCCTGGCTGCAGGGCTCTAGCCTTCCATGCGCCTACTGAATG

CATGAAGAGCCCTGGACATCTAGGAATGCCTTTCTTCTCTCGTTCCCTGGCATACTGCTCTAAGCAAAGGTCAAGGGATTTCTGTGCCTAGTATTACCCA

TAACTTCAAGACTCCTAACAGACTGAATTGGGGATGGGAACACTTTGGGGGAGGGAAAACTGTAAATAGCTCCACTAGTTGTCCAACAGCTTGTTGGTTA

AGTGTTAAGAGTGGTGGTGGTGGTGGGGGGGTAGGAATGTTGCCATTAAAATGG
Translation
 - UNI15770 -  - UNI16967 - MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERG - UNI23748 - RRGSKKGSIDV

EKITCVETVIPEKNPPPERQIP - UNI21615 - RRGEESSEMEQISIIERFPYPFQ - UNI22994 - VVYDEGPLYVFSPTEELRKRWIHQLKN

V VIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGS - UNI27140 - SLKPGSSHRKTKKPLPPTPEEDQ ILKKPLPPEPTAAPIS

TTELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNG GQEGYIPSNYITEAEDSIEMYE EWYSKHMTRSQAEQLLKQE GKEGGFIVR

DSSKAGKYTVSVFAKSTG GEPQGVIRHYVVCSTPQSQYYL AARNCLVNDQGVVKVSDFGLSR RYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKS

DIWAFG - UNI37393 - GVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHE - UNI29129 - - UNI37393 - 

KADERPSFKILLSNILDVMDEES
Transcript ENSMUST00000113214
Sequence
TAAGAATATGTCTCCAGGTCCAGAGTCTTCAGAGATCAAGTCCCACCTTCCAAGTCCTGGCATCTCACGACGTCTGGGGAGCTACCTGCATTAAGTCAGA

ACTGAG - UNI15770 - - UNI16967 - TACACAAACAAGTTCCAGAGAGAGGAAGCCATGGCTGCAGTGATACTGGAGAGCATCTTTCTGAAGC

GCTCCCAGCAGAAAAAGAAAACATCACCTTTAAACTTCAAGAAGCGCCTGTTTCTCTTGACTGTACACAAACTTTCATACTATGAATATGACTTTGAACG

TGGG - UNI23748 - AGAAGAGGCAGTAAGAAAGGTTCAATAGATGTTGAGAAGATCACCTGTGTTGAAACAGTAATTCCTGAAAAAAATCCCCCAC

CAGAAAGACAGATTCCG - UNI21615 - AGGAGAGGTGAGGAGTCTAGTGAAATGGAACAGATTTCAATCATTGAAAGGTTCCCGTACCCATTCCAG

 - UNI22994 - GTTGTATATGATGAAGGACCTCTCTATGTTTTCTCCCCAACTGAAGAGCTGAGAAAGCGCTGGATTCACCAGCTCAAAAATG TAA

TCCGGTACAATAGTGACCTGGTACAGAAATACCATCCTTGCTTCTGGATTGATGGACAGTATCTCTGCTGCTCTCAGACAGCCAAGAATGCTATGGGCTG

CCAAATTTTGGAGAACAGGAATGGAA - UNI27140 - GCTTAAAACCTGGGAGTTCTCATCGAAAAACGAAAAAGCCTCTTCCCCCTACCCCAGAGG

AAGATCAG ATCTTGAAAAAACCGCTTCCCCCGGAGCCAACAGCAGCACCAATCTCCACAACCGAGCTGAAAAAGGTCGTGGCCCTTTATGATTACATGC

CAATGAACGCAAATGACTTACAATTGCGAAAGGGCGAGGAGTATTTTATCCTGGAGGAGAGCAACCTACCGTGGTGGCGAGCACGAGATAAAAATGG GC

AGGAAGGCTACATCCCAAGTAACTATATCACTGAAGCTGAGGACTCCATAGAGATGTATGA GTGGTATTCCAAGCACATGACTCGAAGTCAAGCTGAGC

AACTGCTAAAGCAAGAG GGGAAAGAAGGAGGTTTCATTGTCAGAGACTCCAGCAAAGCTGGAAAATACACCGTGTCTGTGTTTGCTAAATCTACTGG G

GAGCCTCAAGGGGTGATCCGCCATTACGTTGTGTGTTCCACGCCACAGAGCCAGTATTACCTG GCAGCTCGAAACTGTTTGGTAAACGATCAAGGAGTT

GTGAAAGTATCTGACTTTGGCCTGTCTAG GTATGTCCTTGATGATGAGTACACCAGCTCTGTAGGCTCCAAGTTTCCAGTCCGGTGGTCTCCACCAGAA

GTGCTTATGTATAGCAAGTTCAGCAGCAAATCTGACATCTGGGCTTTTG - UNI37393 - GGGTTTTAATGTGGGAGATCTACTCCCTGGGGAAGAT

GCCGTATGAGAGATTTACTAACAGTGAGACAGCAGAACACATTGCTCAAGGCTTACGTCTCTACAGGCCTCATCTGGCATCAGAGAGGGTATATACCATC

ATGTACAGCTGCTGGCACGAG - UNI29129 - - UNI37393 - AAAGCAGATGAACGTCCTAGTTTCAAAATTCTCTTGAGTAACATTCTAGATG

TGATGGATGAAGAATCCTGAGCTGGCTGCTAAGCTCCGTGGATCTCCTCCTCTCTCCTACAAAACCTAATTCCATGTTTCCTGAGGAGTTCCCTGGCTGC

AGGGCTCTAGCCTTCCATGCGCCTACTGAATGCATGAAGAGCCCTGGACATCTAGGAATGCCTTTCTTCTCTCGTTCCCTGGCATACTGCTCTAAGCAAA

GGTCAAGGGATTTCTGTGCCTAGTATTACCCATAACTTCAAGACTCCTAACAGACTGAATTGGGGATGGGAACACTTTGGGGGAGGGAAAACTGTAAATA

GCTCCACTAGTTGTC
Translation
 - UNI15770 - - UNI16967 - MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERG - UNI23748 - RRGSKKGSIDVE

KITCVETVIPEKNPPPERQIP - UNI21615 - RRGEESSEMEQISIIERFPYPFQ - UNI22994 - VVYDEGPLYVFSPTEELRKRWIHQLKNV

 VIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGS - UNI27140 - SLKPGSSHRKTKKPLPPTPEEDQ ILKKPLPPEPTAAPIST

TELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNG GQEGYIPSNYITEAEDSIEMYE EWYSKHMTRSQAEQLLKQE GKEGGFIVRD

SSKAGKYTVSVFAKSTG GEPQGVIRHYVVCSTPQSQYYL AARNCLVNDQGVVKVSDFGLSR RYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSD

IWAFG - UNI37393 - GVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHE - UNI29129 - - UNI37393 - K

ADERPSFKILLSNILDVMDEES
Transcript ENSMUST00000033617
Sequence
TAAGAATATGTCTCCAGGTCCAGAGTCTTCAGAGATCAAGTCCCACCTTCCAAGTCCTGGCATCTCACGACGTCTGGGGAGCTACCTGCATTAAGTCAGA

ACTGAG - UNI15770 - - UNI16967 - TACACAAACAAGTTCCAGAGAGAGGAAGCCATGGCTGCAGTGATACTGGAGAGCATCTTTCTGAAGC

GCTCCCAGCAGAAAAAGAAAACATCACCTTTAAACTTCAAGAAGCGCCTGTTTCTCTTGACTGTACACAAACTTTCATACTATGAATATGACTTTGAACG

TGGG - UNI23748 - AGAAGAGGCAGTAAGAAAGGTTCAATAGATGTTGAGAAGATCACCTGTGTTGAAACAGTAATTCCTGAAAAAAATCCCCCAC

CAGAAAGACAGATTCCG - UNI21615 - AGGAGAGGTGAGGAGTCTAGTGAAATGGAACAGATTTCAATCATTGAAAGGTTCCCGTACCCATTCCAG

 - UNI22994 - GTTGTATATGATGAAGGACCTCTCTATGTTTTCTCCCCAACTGAAGAGCTGAGAAAGCGCTGGATTCACCAGCTCAAAAATG TAA

TCCGGTACAATAGTGACCTGGTACAGAAATACCATCCTTGCTTCTGGATTGATGGACAGTATCTCTGCTGCTCTCAGACAGCCAAGAATGCTATGGGCTG

CCAAATTTTGGAGAACAGGAATGGAA - UNI27140 - GCTTAAAACCTGGGAGTTCTCATCGAAAAACGAAAAAGCCTCTTCCCCCTACCCCAGAGG

AAGATCAG ATCTTGAAAAAACCGCTTCCCCCGGAGCCAACAGCAGCACCAATCTCCACAACCGAGCTGAAAAAGGTCGTGGCCCTTTATGATTACATGC

CAATGAACGCAAATGACTTACAATTGCGAAAGGGCGAGGAGTATTTTATCCTGGAGGAGAGCAACCTACCGTGGTGGCGAGCACGAGATAAAAATGG GC

AGGAAGGCTACATCCCAAGTAACTATATCACTGAAGCTGAGGACTCCATAGAGATGTATGA GTGGTATTCCAAGCACATGACTCGAAGTCAAGCTGAGC

AACTGCTAAAGCAAGAG GGGAAAGAAGGAGGTTTCATTGTCAGAGACTCCAGCAAAGCTGGAAAATACACCGTGTCTGTGTTTGCTAAATCTACTGG G

GAGCCTCAAGGGGTGATCCGCCATTACGTTGTGTGTTCCACGCCACAGAGCCAGTATTACCTGGCTGAGAAACACCTCTTCAGCACCATCCCTGAGCTCA

TTAACTACCATCAACACAACTCTGCAG GCCTCATATCCAGGCTGAAATATCCTGTGTCTAAACAAAACAAAAACGCGCCTTCTACTGCAGGCCTGGGCT

ATG GATCATGGGAAATTGATCCAAAGGACCTCACCTTCTTGAAGGAGCTTGGGACTGGACAATTCGGTGTCGTGAAATATGGGAAGTGGAGGGGCCAAT

ATGATGTGGCCATCAAGATGATCAGAGAAGGTTCCATGTCGGAGGATGAATTCATTGAAGAAGCCAAAGTCATGAT GAATCTTTCCCATGAGAAGCTGG

TGCAGTTGTATGGCGTCTGCACCAAACAACGCCCCATCTTCATCATCACCGAGTACATGGCTAATGGCTGCCTCTTGAACTACCTGAGGGAGATGCGGCA

CCGCTTCCAGACACAGCAGCTGCTTGAGATGTGCAAAGATGTCTGTGAAGCAATGGAATACTTGGAGTCGAAGCAGTTCCTTCACAGAGACCTG GCAGC

TCGAAACTGTTTGGTAAACGATCAAGGAGTTGTGAAAGTATCTGACTTTGGCCTGTCTAG GTATGTCCTTGATGATGAGTACACCAGCTCTGTAGGCTC

CAAGTTTCCAGTCCGGTGGTCTCCACCAGAAGTGCTTATGTATAGCAAGTTCAGCAGCAAATCTGACATCTGGGCTTTTG - UNI37393 - GGGTTT

TAATGTGGGAGATCTACTCCCTGGGGAAGATGCCGTATGAGAGATTTACTAACAGTGAGACAGCAGAACACATTGCTCAAGGCTTACGTCTCTACAGGCC

TCATCTGGCATCAGAGAGGGTATATACCATCATGTACAGCTGCTGGCACGAG - UNI29129 - - UNI37393 - AAAGCAGATGAACGTCCTAGT

TTCAAAATTCTCTTGAGTAACATTCTAGATGTGATGGATGAAGAATCCTGAGCTGGCTGCTAAGCTCCGTGGATCTCCTCCTCTCTCCTACAAAACCTAA

TTCCATGTTTCCTGAGGAGTTCCCTGGCTGCAGGGCTCTAGCCTTCCATGCGCCTACTGAATGCATGAAGAGCCCTGGACATCTAGGAATGCCTTTCTTC

TCTCGTTCCCTGGCATACTGCTCTAAGCAAAGGTCAAGGGATTTCTGTGCCTAGTATTACCCATAACTTCAAGACTCCTAACAGACTGAATTGGGGATGG

GAACACTTTGGGGGAGGGAAAACTGTAAATAGCTCCACTAGTTGTCCAACAGCTTGTTGGTTAAGTGTTAAGAGTGGTGGTGGTGGTGGGGGGGTAGGAA

TGTTGCCATTAA
Translation
 - UNI15770 - - UNI16967 - MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERG - UNI23748 - RRGSKKGSIDVE

KITCVETVIPEKNPPPERQIP - UNI21615 - RRGEESSEMEQISIIERFPYPFQ - UNI22994 - VVYDEGPLYVFSPTEELRKRWIHQLKNV

 VIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGS - UNI27140 - SLKPGSSHRKTKKPLPPTPEEDQ ILKKPLPPEPTAAPIST

TELKKVVALYDYMPMNANDLQLRKGEEYFILEESNLPWWRARDKNG GQEGYIPSNYITEAEDSIEMYE EWYSKHMTRSQAEQLLKQE GKEGGFIVRD

SSKAGKYTVSVFAKSTG GEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAG GLISRLKYPVSKQNKNAPSTAGLGYG GSWEIDPKDL

TFLKELGTGQFGVVKYGKWRGQYDVAIKMIREGSMSEDEFIEEAKVMM MNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLE

MCKDVCEAMEYLESKQFLHRDL AARNCLVNDQGVVKVSDFGLSR RYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFG - UNI37393 -

 GVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHE - UNI29129 - - UNI37393 - KADERPSFKILLSNILDVM

DEES

For any suggestions or comments, please send an email to unitrap@crg.es