Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031266 (Gla)
Chromosomal location
Chr X: 131122895 - 131135494 (-)
Description
galactosidase, alpha Gene [Source:MGI (curated);Acc:Gla-001]
RefSeq_dna
NM_013463 
RefSeq_peptide
NP_038491.2 
MGI
MGI:1347344 
Uniprot/SWISSPROT
P51569 
Uniprot/SPTREMBL
A2BDV6 Q3TLY5 Q3UM38 Q8BGZ6 
Human Ortholog
ENSG00000102393 (GLA)
Omim 301500 - FABRY DISEASE  
UniTrap UNI18639
Vector Insertion
Chr X: 131130989 - 131135276
Public Clones IST12452G12 (tigm)
Private Clones OST418880 (lexicon) OST80371 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20752
Vector Insertion
Chr X: 131128265 - 131129718
Public Clones not available
Private Clones OST353085 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33766
Vector Insertion
Chr X: 131125484 - 131126766
Public Clones IST10490A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033621
Sequence
CTGAACCAAAGGATTTCTATGGCCATGAAGCTTTTGAGCAGAGATACGCGGCTGGTCTGTGAGCTTGCGCTTTGTCCCCTGGCTTTAGTTTTCTGGAGCA

TTCTTGGGGTCAGAGCATTGGACAATGGCTTGGCGCGGACTCCTACTATGGGCTGGCTGCATTGGGAACGTTTCATGTGCAACCTTGACTGCCAAGAAGA

GCCTGATGCCTGCATAAG - UNI18639 - TGAGCAACTGTTCATGCAGATGGCAGAGCTCATGGTCTCTGATGGCTGGCGGGATGCAGGTTATGACT

ATCTCTGCATAGATGACTGTTGGATGGCTCCCGAGAGGGATTCAAAGGGCAGGCTTCAGGCAGATCCCCAACGCTTTCCTAGTGGGATCAAACACCTCGC

AAATTAC GTCCACAGCAAAGGATTGAAGCTAGGGATTTATGCAGATGTTGGGAATAAAACCTGTGCAGGTTTCCCCGGGAGTTTTGGATCCTATGACAT

TGATGCGCAGACATTTGCTGACTGGGGCGTAGATCTGCTAAAATTTGATGGTTGTCACTGTGACAGTGTAGTATCCTTGGAGAATG - UNI20752 - 

GTTATAAGTACATGGCCTTGGCCTTGAACAGGACAGGCCGAAGCATTGTATACTCCTGTGAGTGGCCACTTTATTTGAGACCCTTTCATAAG - UNI33

766 - CCCAATTATACAGATATCCAATATTACTGCAATCATTGGAGAAATTTTGATGATGTTTATGATTCCTGGGAAAGCATAAAGAATATCTTGTCTT

GGACAGTGGTTTACCAGAAGGAGATTGTTGAAGTCGCTGGACCAGGCAGCTGGAATGACCCAGACATG - UNI33766 - TTAGTGATCGGCAACTTT

GGCCTCAGTTGGGACCAGCAGGTGACACAGATGGCCCTCTGGGCTATCATGGCCGCTCCCCTACTCATGTCCAACGATCTGCGACAAATCAGCTCTCAAG

CCAAAGCTCTGCTTCAGAATAAGGATGTAATTGCCATCAACCAAGACCCCTTGGGCAAGCAGGGCTACTGTTTCAGAAAG - UNI33766 - GAAAAC

CACATTGAGGTTTGGGAACGGCCACTCTCCAACCTAGCCTGGGCTGTGGCTGTGAGAAACCTGCAGGAGATTGGTGGACCTTGTCCTTATACCATCCAGA

TTTCTTCCCTGGGTAGAGGACTAGCCTGCAATCCTGGCTGCATCATTACTCAGCTTCTCCCCGAGAAAGTACACCTAGGCTTCTATGAATGGACTTTGAC

CTTAAAAACTCGAGTAAACCCCTCAGGCACTGTTTTGTTTCGGTTAGAAAGATAAACTACTATATAGGCAGAGTTCTATGTCCCGTTTTACTACAAACCA

AACTATTTCCTGCCCCTCCCTCTAAAAATAAAGTATCCCAAAGGCATTGCCCTTAAAAGCTGCTTTTCAACATAGGCTTTTGAAATTAAGTGGGTACTCC

TGTGCAATATTCCGAGGTGGACTGGGAGGAGGGTAAAAGTGTGGAATGTATTGAAAACAGATTTCAAAAAAAAAGTCTCTACTTCGGGTTTTCTTATAAC

TTGTAACCGGTAGGCTGTAGCAGATGCTTCCGTACACTGGTTGATTTTAACCTTCACAACCCTGAAGCAGCTGTTTATCCACTATAATCTTTACAGCCAA

GTCAAAAGCAACAAAAAACCCTTTAGATGTATGTGGTTCAAGAGTTTTGCCTGTATGTATGAGGTCCACATACATACCGGGTGCCCAGGAAGCCAGAAGA

ACAAGTGCTTTTTTTTCCCCAAGACAGGGTTTCTCCATATAGCCCTGGCTGTCCTGGAACTCACTCTGTAGACCAGGATGGCCTTGAATTTAGAAATCCG

CCTGCCTCAGCCTCCAAAGTGCTGGGATTAAAGGCCTGCGCCACCACCGCCCAGCCTTTTTTGTTGTTTTGACAAGTGCCCTTAATCACTGAGCCAGCAA

GCTCTAGCACCCAGAACCAGGATTTAAAGCTAAACCAGCCAGACACAAATAACTATATGGAGGCACTGCTTAGTCTAGTGCAAAGGAAAAAATGAAAATC

TGCTTCCTCCAGGTGACAGACTGGATGTGGTAGCATGTCCTTAATCCCAGTACTAGGGAGGCAATGGCAAGTATAATTCAAGGCCAGCCTGGACTACAAA

GTGCAAGCCTGGCTGGAAACAAACTCATATGCCCAGGTTATCCCCTAGAGCTAAGAAATGCAGATAGGATTACCTGTATTTACCAATGGTGATTGGCTAC

ATGATGTCCTAAGAGCAATTGATGAACTGTCCTGGTGACAAACTGGGGGATTCGGGAGGAAAAAGGTTTGGAAGGATGCTCAGGTGTTATTTTACACAAA

GCCAGTATGATGGTGTTCCATGCCTCCAATTCCAGCACTTGGTGAGGATAAGGCCAGAGAAACCCAGGGGAGGAACTAGGGACACTTCCAACAATCTAAA

ACAAGGGATGTATATTGAAGCATGCTCCCCAGACTCCCTTAATGCCTGAAGTGCCCAGCAGTGGTAGCACACGCCTTTAATCCTAGCACTTAGGAGGCAG

AGGCAGCCGGATGAGTTCTGAATTCGAGGCCAGCCTGGTCTACAGAGTTCCAGGACAGCCAGGGCTATACAGAGAAACCCTGTCTCAGGGGAAAAAAATG

AGGGCCTGGAGAAATGATTCAGCGGTTAAGAGGATTGACTGCTCTTCCAAAGGTCATGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAATAATCTG

CAATGAGATCTGATGCCCTCTTCTGGTTCTCTAGACAGCAACATTATACTTGCATAATAATCTTTT
Translation
MAMKLLSRDTRLVCELALCPLALVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQEEPDACIS - UNI18639 - SEQLFMQMAELMVSDGWRD

AGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIKHLANY VHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVVSLEN

G - UNI20752 - GYKYMALALNRTGRSIVYSCEWPLYLRPFHK - UNI33766 - PNYTDIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEI

VEVAGPGSWNDPDM - UNI33766 - LVIGNFGLSWDQQVTQMALWAIMAAPLLMSNDLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRK - UNI

33766 - ENHIEVWERPLSNLAWAVAVRNLQEIGGPCPYTIQISSLGRGLACNPGCIITQLLPEKVHLGFYEWTLTLKTRVNPSGTVLFRLER

For any suggestions or comments, please send an email to unitrap@crg.es