Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031304 (Il2rg)
Chromosomal location
Chr X: 98456716 - 98464362 (-)
Description
interleukin 2 receptor, gamma chain Gene [Source:MGI (curated);Acc:Il2rg-005]
RefSeq_dna
NM_013563 NM_001033362 
RefSeq_peptide
NP_038591.1 NP_001028534.1 
UniGene
Mm.2923 Mm.404153 
MGI
MGI:2685460 MGI:96551 
Uniprot/SWISSPROT
P34902 Q3V2K1 
Uniprot/SPTREMBL
B0QZX1 Q3UPA9 A2AGH5 
Human Ortholog
ENSG00000147168 (IL2RG)
Omim 300400 - SEVERE COMBINED IMMUNODEFICIENCY, X-LINKED  312863 - COMBINED IMMUNODEFICIENCY, X-LINKED  
UniTrap UNI28088
Vector Insertion
Chr X: 98457339 - 98457717
Public Clones not available
Private Clones OST40230 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18925
Vector Insertion
Chr X: 98456837 - 98457171
Public Clones not available
Private Clones OST410930 (lexicon) OST410926 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033664
Sequence
GACACAGACTACACCCAGAGAAAGAAGAGCAAGCACCATGTTGAAACTATTATTGTCACCTAGATCCTTCTTAGTCCTTCAGCTGCTCCTGCTGAGGGCA

GGGTGGAGCTCCAAGGTCCTCATGTCCAGTGCGAATGAAGACATCAAAGCTG ATTTGATCCTGACTTCTACAGCCCCTGAACACCTCAGTGCTCCTACT

CTGCCCCTTCCAGAGGTTCAGTGCTTTGTGTTCAACATAGAGTACATGAATTGCACTTGGAATAGCAGTTCTGAGCCTCAGGCAACCAACCTCACGCTGC

ACTATAG GTACAAGGTATCTGATAATAATACATTCCAGGAGTGCAGTCACTATTTGTTCTCCAAAGAGATTACTTCTGGCTGTCAGATACAAAAAGAAG

ATATCCAGCTCTACCAGACATTTGTTGTCCAGCTCCAGGACCCCCAGAAACCCCAGAGGCGAGCTGTACAGAAGCTAAACCTACAGAATCTTG TGATCC

CACGGGCTCCAGAAAATCTAACACTCAGCAATCTGAGTGAATCCCAGCTAGAGCTGAGATGGAAAAGCAGACATATTAAAGAACGCTGTTTACAATACTT

GGTGCAGTACCGGAGCAACAGAGATCGAAGCTGGACG GAACTAATAGTGAATCATGAACCTAGATTCTCCCTGCCTAGTGTGGATGAGCTGAAACGGTA

CACATTTCGGGTTCGGAGCCGCTATAACCCAATCTGTGGAAGTTCTCAACAGTGGAGTAAATGGAGCCAGCCTGTCCACTGGGGGAGTCATACTGTAGAG

G AGAATCCTTCCTTGTTTGCACTGGAAGCTGTGCTTATCCCTGTTGGCACCATGGGGTTGATTATTACCCTGATCTTTGTGTACTGTTGGTTGGAACG 

AATGCCTCCAATTCCCCCCATCAAGAATCTAGAGGATCTGGTTACTGAATACCAAGGGAACTTTTCG GCCTGGAGTGGTGTGTCTAAAGGGCTGACTGA

GAGTCTGCAGCCAGACTACAGTGAACGGTTCTGCCACGTCAGCGAGATTCCCCCCAAAGGAGGGGCCCTAGGAGAGGGGCCTGGAGGTTCTCCTTGCAGC

CTGCATAGCCCTTACTGGCCTCCCCCATGTTATTCTCTGAAGCCGGAAGCCTGAACATCAATCCTTTGATGGAACCTCAAAGTCCTATAGTCCTAAGTGA

CGCTAACCTCCCCTACTCACCTTGGCAATCTGGATCCAATGCTCACTGCCTTCCCTTGGGGCTAAGTTTCGATTTCCTGTCCCATGTAACTGCTTTTCTG

TTCCATATGCCCTACTTGAGAGTGTCCCTTGCCCTCTTTCCCTGCACAAGCCCTCCCATGCCCAGCCTAACACCTTTCCACTTTCTTTGAAGAGAGTCTT

ACCCTGTAGCCCAGGGTGGCTGGGAGCTCACTATGTAGGCCAGGTTGGCCTCCAACTCACAGGCTATCCTCCCACCTCTGCCTCATAAGAGTTGGGGTTA

CTGGCATGCACCACCACACCCAGCATGGTCCTTCTCTTTTATAGGATTCTCCCTCCCTTTTTCTACCTATGATTCAACTGTTTCCAAATCAACAAGAAAT

AAAGTTTTTAACCAATGAT
Translation
MLKLLLSPRSFLVLQLLLLRAGWSSKVLMSSANEDIKAD DLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYR RYKVSDN

NTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLV VIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNR

DRSWT ELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEE ENPSLFALEAVLIPVGTMGLIITLIFVYCWLER RMPP

IPPIKNLEDLVTEYQGNFS AWSGVSKGLTESLQPDYSERFCHVSEIPPKGGALGEGPGGSPCSLHSPYWPPPCYSLKPEA
Transcript ENSMUST00000101358
Sequence
GTCTGCCTAGTCTGGGCCTCCTCCAGTCTCTAAAATAATCTGCTCCTTCATGCCCAACCCCTATGCTTAGGACCCTAGGGTCCTAGAGCACCTTCCATCT

GCATGATCCATCAAGGGGTGAAGGATGAAATGACATAAGTAGCATGTTTATCATCATCAAACATGGAG ACAATCAAGAGTTTCTGGTCAATTCCAATTG

CTCTGTCCTCCTGTTGCTACATTACATCCGAAAGAAAATGAAATTACGGAAAACAG ACACCATTGATTTGTGTGATGAATCGGGAACCATGAAGTTACT

CTTCCTGTCAAAGACACCTGGAGACTCTGCCAGCAAATTCCTTACAGCTCGAAATACCTACTATGTTTGTAAAGTGGAACGTGGGGCACCAG GTACCAG

AATTGAGAATTCCTACAAAGCTATTGTGCCCATGCTGAAGAATCCAGAACCTGAACTAGTTG - UNI28088 - ACTCGCTGCGCACACAATGTGACT

TCCTGGAGAGGAGCAGAATAAAGATGCTTAGAACTCTAGAAGCCAAGAGACTGGCAGCCATGGAATCCTCTGTAAATCTCCCAGCAAGGTCTCCCAAGGG

TGGTGGAGCCCAGCAGACTACTAGCACAAGCAGTCAACTGAAG - UNI18925 - TCTAAAGGTGGGCGATCAGATGAAGACGGACCACCTTCCACCC

GCAGACCATTCTACAAGACTAGAGCAGACTTTCTCAAGAGACATCGTTAACTCAATACAAAGACCAAGTGAGAGCAGC
Translation
MFIIIKHGD DNQEFLVNSNCSVLLLLHYIRKKMKLRKTD DTIDLCDESGTMKLLFLSKTPGDSASKFLTARNTYYVCKVERGAPG GTRIENSYKAIV

PMLKNPEPELVD - UNI28088 - DSLRTQCDFLERSRIKMLRTLEAKRLAAMESSVNLPARSPKGGGAQQTTSTSSQLK - UNI18925 - SKGG

RSDEDGPPSTRRPFYKTRADFLKRHR
Transcript ENSMUST00000117736
Sequence
ATGGACTGGAGAGCAGAGGCCCTTGAGAAAGGGGACCAGTTTGTGGGTTACGGGAATAATCATGACTGGAG GTACAAGGTATCTGATAATAATACATTC

CAGGAGTGCAGTCACTATTTGTTCTCCAAAGAGATTACTTCTGGCTGTCAGATACAAAAAGAAGATATCCAGCTCTACCAGACATTTGTTGTCCAGCTCC

AGGACCCCCAGAAACCCCAGAGGCGAGCTGTACAGAAGCTAAACCTACAGAATCTTG TGATCCCACGGGCTCCAGAAAATCTAACACTCAGCAATCTGA

GTGAATCCCAGCTAGAGCTGAGATGGAAAAGCAGACATATTAAAGAACGCTGTTTACAATACTTGGTGCAGTACCGGAGCAACAGAGATCGAAGCTGGAC

G GAACTAATAGTGAATCATGAACCTAGATTCTCCCTGCCTAGTGTGGATGAGCTGAAACGGTACACATTTCGGGTTCGGAGCCGCTATAACCCAATCTG

TGGAAGTTCTCAACAGTGGAGTAAATGGAGCCAGCCTGTCCACTGGGGGAGTCATACTGTAGAGG AGAATCCTTCCTTGTTTGCACTGGAAGCTGTGCT

TATCCCTGTTGGCACCATGGGGTTGATTATTACCCTGATCTTTGTGTACTGTTGGTTGGAACG AATGCCTCCAATTCCCCCCATCAAGAATCTAGAGGA

TCTGGTTACTGAATACCAAGGGAACTTTTCG GCCTGGAGTGGTGTGTCTAAAGGGCTGACTGAGAGTCTGCAGCCAGACTACAGTGAACGGTTCTGCCA

CGTCA ACAATCAAGAGTTTCTGGTCAATTCCAATTGCTCTGTCCTCCTGTTGCTACATTACATCCGAAAGAAAATGAAATTACGGAAAACAG ACACCA

TTGATTTGTGTGATGAATCGGGAACCATGAAGTTACTCTTCCTGTCAAAGACACCTGGAGACTCTGCCAGCAAATTCCTTACAGCTCGAAATACCTACTA

TGTTTGTAAAGTGGAACGTGGGGCACCAG GTACCAGAATTGAGAATTCCTACAAAGCTATTGTGCCCATGCTGAAGAATCCAGAACCTGAACTAGTTG 

- UNI28088 - ACTCGCTGCGCACACAATGTGACTTCCTGGAGAGGAGCAGAATAAAGATGCTTAGAACTCTAGAAGCCAAGAGACTGGCAGCCATGG

AATCCTCTGTAAATCTCCCAGCAAGGTCTCCCAAGGGTGGTGGAGCCCAGCAGACTACTAGCACAAGCAGTCAACTGAAG - UNI18925 - TCTAAA

GGTGGGCGATCAGATGAAGACGGACCACCTTCCACCCGCAGACCATTCTACAAGACTAGAGCAGACTTTCTCAAGAGACATCGTTAA
Translation
MDWRAEALEKGDQFVGYGNNHDWR RYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLV VIPRAPENLTL

SNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWT ELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEE ENPSLF

ALEAVLIPVGTMGLIITLIFVYCWLER RMPPIPPIKNLEDLVTEYQGNFS AWSGVSKGLTESLQPDYSERFCHVN NNQEFLVNSNCSVLLLLHYIRK

KMKLRKTD DTIDLCDESGTMKLLFLSKTPGDSASKFLTARNTYYVCKVERGAPG GTRIENSYKAIVPMLKNPEPELVD - UNI28088 - DSLRTQ

CDFLERSRIKMLRTLEAKRLAAMESSVNLPARSPKGGGAQQTTSTSSQLK - UNI18925 - SKGGRSDEDGPPSTRRPFYKTRADFLKRHR

For any suggestions or comments, please send an email to unitrap@crg.es