Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031311 (Nono)
Chromosomal location
Chr X: 98625028 - 98643929 (+)
Description
non-POU-domain-containing, octamer binding protein Gene [Source:MGI (curated);Acc:Nono-001]
RefSeq_dna
NM_023144 
RefSeq_peptide
NP_075633.1 
UniGene
Mm.280069 Mm.327936 Mm.469986 Mm.475350 
MGI
MGI:1855692 
Uniprot/SWISSPROT
Q99K48 
Uniprot/SPTREMBL
B1AXT0 Q3TF40 Q3TFC2 Q3TMM5 Q3TTV7 Q3UM20 Q4FK11 
Human Ortholog
ENSG00000147140 (NONO)
Omim not available
UniTrap UNI10491
Vector Insertion
Chr X: 98625102 - 98625831
Public Clones H009E01 (ggtc) M023D08 (ggtc) P030B07 (ggtc) H003A06 (ggtc) P122C11 (ggtc)
P112C11 (ggtc)
Private Clones OST171645 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6843
Vector Insertion
Chr X: 98625892 - 98632547
Public Clones (sanger) YHA266 (baygenomics) P130D08 (ggtc) E086B07 (ggtc) D147E04 (ggtc)
H009E01 (ggtc) D009D04 (ggtc) E089G04 (ggtc) PST13349-NL (escells) PST10873-NR (escells)
PST6943-NR (escells) PST2842-NR (escells) PST17299-NR (escells) PST14969-NR (escells)
PST12212-NL (escells) PST9300-NL (escells) PST3686-NR (escells) PST234-1 (escells)
PST24006-NR (escells) PST13962-NR (escells) PST11058-NL (escells) PST8728-NR (escells)
PST2962-NR (escells) PST18321-NL (escells) PST13218-NR (escells) PST4146-NR (escells)
PST9473-NR (escells) PST5579-NL (escells) PST25004-NR (escells) PST5594-NL (escells)
PST11597-NR (escells) PST9299-NL (escells) PST3061-NR (escells) PST1216-1 (escells)
PST23430-NR (escells) PST13857-NR (escells) PST10457-NR (escells) PST7355-NR (escells)
PST5836-NR (escells) PST17620-NR (escells) PST14938-NR (escells) PST12248-NL (escells)
PST5594-NR (escells) PST7044-NR (escells) PST1157-2 (escells) PST24167-NR (escells)
PST234-3 (escells) PST11426-NR (escells) PST8764-NR (escells) PST5977-NL (escells)
PST19411-NL (escells) PSTVU01.HE60U (vanderbilt) IST12457D4 (tigm)
IST14717B7 (tigm) IST14375H10 (tigm)
Private Clones OST391184 (lexicon) OST377324 (lexicon) OST291096 (lexicon) OST257641 (lexicon)
OST122499 (lexicon) OST122496 (lexicon) OST120746 (lexicon) OST106720 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14745
Vector Insertion
Chr X: 98632717 - 98634825
Public Clones PST14687-NR (escells) PST3004-NL (escells) PST11721-NR (escells) PST587-1 (escells)
PST1597-1 (escells) PST6243-NL (escells) PST3956-NR (escells) PST11424-NR (escells)
PST14955-NR (escells) PST8580-NR (escells) PST175-3 (escells) PST2501-NR (escells)
PST6243-NR (escells) IST10511G12 (tigm)
Private Clones OST196999 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37519
Vector Insertion
Chr X: 98635020 - 98636854
Public Clones PST17298-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31504
Vector Insertion
Chr X: 98638831 - 98639615
Public Clones IST12315G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20884
Vector Insertion
Chr X: 98641568 - 98642932
Public Clones PST21077-NR (escells) PST22466-NR (escells)
Private Clones OST348981 (lexicon) OST264561 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033673
Sequence
GCGCGCTCTTTTCTCGGGACGGTGGAGGCCGTGCAGCGTCGCCCATACTCCGAGCAAAGAACTGTGGCCAGAGG - UNI10491 - CAGTCGAGGTTA

GTGAGGACTGCGAGGCAGACACTTTGCTGTGTTCAAATCCAAGTCAAG - UNI6843 - GGTACAAAAATGCAGAGCAATAAAGCCTTTAACTTGGAG

AAGCAGAATCATACTCCAAGGAAGCATCATCAGCATCACCACCAGCAGCACCATCAGCAGCAACAGCAGCAGCAGCAGCAACAGCCACCCCCACCAATAC

CTGCAAATGGCCAGCAGGCCAGCAGCCAGA - UNI14745 - ATGAAGGCTTGACTATTGACCTGAAGAATTTTAGGAAACCAGGAGAGAAGACCTTT

ACACAGCGTAGCCGTCTCTTTGTGGGCAATCTTCCCCCTGATATCACTGAGGAGGAAATGAGGAAACTATTTGAGAAATATGGAAAAGCAGGCGAAGTTT

TCATTCATAAGGATAAAGGCTTTGGCTTTATTCGCTTG - UNI37519 - GAAACACGAACCCTAGCGGAAATTGCCAAAGTGGAGCTGGACAACATG

CCCCTCCGTGGGAAGCAGCTGCGAGTGCGCTTTGCCTGTCACAGTGCATCCCTTACAGTCCGCAACCTTCCTCAGTACGTGTCGAACGAACTGCTGGAAG

AAGCCTTTTCTGTGTTCGGCCAGGTGGAGAGGGCTGTAGTCATTGTGGATGACCGAGGAAGGCCCTCAGGGAAAGGCATTGTTGAGTTCTCAGGGAAGCC

AGCTGCTCGGAAAGCTCTGGACAGATGCAGTGAAGGCTCCTTCTTGCTGACTAC ATTTCCTCGGCCTGTGACTGTGGAGCCTATGGACCAGTTAGATGA

TGAAGAGGGACTTCCAGAGAAACTGGTTATAAAAAACCAGCAATTCCACAA GGAGAGAGAACAGCCACCCAGATTTGCACAACCTGGCTCCTTTGAGTA

TGAGTATGCCATGCGCTGGAAGGCACTCATTGAGATGGAGAAGCAACAGCAGGATCAAGTGGATCGGAACATCAAGGAGGCTCGTGAGAAGCTGGAGATG

GAGATGGAGGCTGCACGTCATGAGCACCAGGTTATGCTAATGAGGCAGG - UNI31504 - ATTTGATGAGACGTCAAGAAGAGCTTCGGAGAATGGA

GGAGCTGCATAACCAAGAGGTTCAGAAGCGAAAGCAGTTAGAACTCAG GCAGGAAGAGGAACGCAGGCGCCGTGAGGAAGAGATGCGGCGACAGCAAGA

GGAAATGATGCGCCGACAGCAGGAAGGATTCAAGGGAACCTTCCCTGATGCG AGAGAACAAGAGATACGGATGGGCCAAATGGCTATGGGAG GTGCTA

TGGGCATAAACAATAGAGGCGCGATGCCCCCTGCTCCTGTGCCACCTGGTACTCCAGCTCCTCCAGGACCTGCCACTATGATGCCAGATGGAACCCTTGG

ATTG - UNI20884 - ACCCCACCAACAACTGAACGTTTTGGCCAAGCTGCAACAATGGAAGGAATTGGAGCAATTGGTGGAACTCCTCCTGCATTCA

ACCGTCCAGCTCCGGGAGCTGAATTTGCTCCAAATAAACGCCGCCGATATTAGATAAAGTTGCATTGTCTAGTTTCCTGCAGCCCTTAAAAGAAGGGCCC

TTTTTGGACTAGCCAGAATTCTACCCTGGAAAAGTGTTAGGGGTTCTTCCCAATAGATAGGCCTTCCCTGCTTGTACTACTCTAGGGAGCATGCTTGAAG

GCAGAGGGGCAAGGGAGGGGTGGTATTCAACAAGTCAAAGTCTGTGGTATATTGCTTTATCAAGACTGTCTGGTGCATTCCTGAACTATATTGATTGTTG

AGGGCCTGGAGAACCATGGGAAAATGAACTCAGAGCTCCATTAATCTTGATCATTCCTTCTCTCTCTTTCTCTCTCTCTTGTTTTAATTACTTTCTCATC

TTTATTCCCCTCAACCCCTGAGACACTGCCATATATACCACAAACCATAAACATCCTCCAATGACCTAGCCCCATCCCTCCATTCACTCCCAGGTAAGAA

TTCAGACAAATGTCCACAGAGGTTACAGCATACGTACGGTTGTGTTATATCTCATATATGACCCCTTCATGTCCTAAGGAAGACATTTTCTCTTAGAGGT

TTTCATTTTAGTATATCTTAAAAGAATCTTGTGTTACCTTGCCTCCATCTTTTTCTTGGGTAAGGACTACACTTTGTGTCTCTGATGTTGCTGTTCACAG

CTTTTCTTGATAGGCCTAGTACAATCTTGGGAACAGGGTTGCTGTGTGGTGAAGGTCTGACAGTAGCTCTTAGTCTTGCCTATCTTAGGTAGCTACGCTG

TGCATTTTTATTGGTATACTATGAATTGTTCCAGATACCTTCAGTTTGGAAAGTTTTCTGAGAAATGGAGACGTCATGCAGCATCACCTTATTAAAATAC

ATTTGAAGCCTTTTC
Translation
 - UNI10491 -  - UNI6843 - MQSNKAFNLEKQNHTPRKHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQN - UNI14745 - NEGLT

IDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRL - UNI37519 - ETRTLAEIAKVELDNMPLRGKQLRVR

FACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTT TFPRPVTVEPMDQLDDEEGLPEKL

VIKNQQFHK KEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQD - UNI31504 - DLMRRQEEL

RRMEELHNQEVQKRKQLELR RQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDA REQEIRMGQMAMGG GAMGINNRGAMPPAPVPPGTPAPPGPAT

MMPDGTLGL - UNI20884 - TPPTTERFGQAATMEGIGAIGGTPPAFNRPAPGAEFAPNKRRRY

For any suggestions or comments, please send an email to unitrap@crg.es