Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031325 (4930519F16Rik)
Chromosomal location
Chr X: 100378512 - 100451944 (-)
Description
RIKEN cDNA 4930519F16 gene Gene [Source:MGI Symbol;Acc:MGI:1922356]
MGI
MGI:1922356 
Uniprot/SPTREMBL
Q8K3S4 B1AWX5 Q8K3S1 Q8K3S2 Q8K3S3 Q8K3S0 Q9D533 
Human Ortholog
not available
Omim not available
UniTrap UNI19786
Vector Insertion
Chr X: 100429609 - 100451162
Public Clones (sanger) 3SD151H04 (ggtc) 5SD151H04 (ggtc) IST11253G10 (tigm) IST14576B2 (tigm)
IST12290C12 (tigm) IST10725E1 (tigm) IST14336E7 (tigm) IST14566C11 (tigm)
IST14699E10 (tigm) IST15050F2 (tigm) IST14515F4 (tigm) IST10854G8 (tigm)
IST10978G6 (tigm) IST14147H8 (tigm) IST14999F2 (tigm) IST14119E1 (tigm)
IST13377D2 (tigm) IST10873E6 (tigm) IST12843H7 (tigm)
Private Clones OST380469 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32266
Vector Insertion
Chr X: 100378511 - 100425514
Public Clones IST13705H12 (tigm) IST13270C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062544
Sequence
ACAACACACCTCTTGCCAGTTGAGTCGAAATGAAGGCTCTACTTTGGCTTTACTGTGTTTTGCTTTTTGTTTGCTACTGCTGGGCTG TGCCCCAAATGT

CAAGACTGAGTGTGAGTTCAAGCTCAGTGACTGGAAATCTACCACCAACGAATAGCTACATTGATATACCATGGCTGGCATCTATGCCTGATAATTGCCA

GGGTACTATCCTGACTACAAGGCTGATTCTTTCAACAGCCAACTGTCTGAAGAAATC - UNI19786 - GAAACCGTTATACCTGGACATTTCAGGAG

TAAATTACCCAGAAAGCACTTCACATGGTCAAAGAATCTGCCTCCACCCCAAGTTTAATCTCAACGATGAAAATGATCCAATGAAAGCAGATATTGGCTT

GGTTATTCTTGAAAAGCCTATCGATGGGGATGAAATACCACTATCCCAGTCCCCTAGTACATCCCTGAAGAGCTGTTCTAAGTGCCAATACAAGAGCTGT

TATGTGTATGAATATCAGA - UNI32266 - GTACAGAGAGCCAGTCCTGTTCTATGTCTCCTAATGAACCACTGGGAACTAGTGGGCCTCATACATA

A
Translation
MKALLWLYCVLLFVCYCWAV VPQMSRLSVSSSSVTGNLPPTNSYIDIPWLASMPDNCQGTILTTRLILSTANCLKKS - UNI19786 - SKPLYLDI

SGVNYPESTSHGQRICLHPKFNLNDENDPMKADIGLVILEKPIDGDEIPLSQSPSTSLKSCSKCQYKSCYVYEYQS - UNI32266 - STESQSCSMS

PNEPLGTSGPHT
Transcript ENSMUST00000061184
Sequence
ACAACACACCTCTTGCCAGTTGAGTCGAAATGAAGGCTCTACTTTGGCTTTACTGTGTTTTGCTTTTTGTTTGCTACTGCTGGGCTG TGCCCCAAATGT

CAAGACTGAGTGTGAGTTCAAGCTCAGTGACTGGAAATCTACCACCAACGAATAGCTACATTGATATACCATGGCTGGCATCTATGCCTGATAATTGCCA

GGGTACTATCCTGACTACAAGGCTGATTCTTTCAACAGCCAACTGTCTGAAGAAATC - UNI19786 - GAAACCGTTATACCTGGACATTTCAGGAG

TAAATTACCCAGAAAGCACTTCACATGGTCAAAGAATCTGCCTCCACCCCAAGTTTAATCTCAACGATGAAAATGATCCAATGAAAGCAGATATTGGCTT

GGTTATTCTTGAAAAGCCTATCGATGGGGATGAAATACCACTATCCCAGTCCCCTAGTACATCCCTGAAGAGCTGTTCTAAGTGCCAATACAAGAGCTGT

TATGTGTATGAATATCAGA GTAGCAAGAAACTTGGAACCAGCAGAGTAAAGAAGATAGATGTGCAGCTGCTAGATTTCTCAATGTGCTACCCCCAACAT

TCCAGTTTAGAGAAGGCCGTGGGCTTGTGTATTCAGAGTCAACCACGGGAAGACTGCTGG - UNI32266 - GTACAGAGAGCCAGTCCTGTTCTATG

TCTCCTAATGAACCACTGGGAACTAGTGGGCCTCATACATAAGACTTCAAAGATATGTCAAAATCCCGCAGTCATCATTAGAACAGCTCCTTACTTTACC

TGGATAAAACAATTCATCAAGGTATCTAAGAAGCTACTAAATCCTACTCGCTCCTTACACTGTAGAACATTGTATGAAAATGAGTATGTTCCCCAAATCA

GACATAGCCATAATTATTTCACAACTCTGGCCTCTAGCGATTATCTCTTGAGGATTTTACAAGGAAACGTAGGTGTTTCTCCACAAACTACACATACCAA

CAATGTACCAACAATCTTTAATTTTAGTGATCTAAATTATCTTGCTGATAGTTATAGATTGTTCCTTGATAAAAACCAGACCCCACAACCTGTCCAGCAA

TTGCCTGTTGCTGGACTTCCAGGAAAATTTGGACAGAATTTAATTCAGTATCAGCCAAATACTCCTCCACATAATATAGGTAATTTAAGTAAATCTCCAC

TATCTCAGGTTATTTCTAACACAACTATATCATATAATTCTTCTAAGGCTGATGGTGATAATTCCTTGGGTTTTGCAGCAAACAATACTGATGAGTCTTT

TGATAAAATCATGGCAGATATAATTAAACAATCAAGCCCAACAGAAGATGATGAAGAGGAACCTGAAAATCTCTATGAGGATAGTATGGCTGATAATTAT

TGGACAGAAAATGTTGCTGATTTAGAAAAATACCAGAATCTTTTGAGGACCATGTCAGAAAAACCTCAGAATCAATATACAACTAAGGCCAGCTTACCAC

CAAATTTATATTTACCTGAAGGAGAGGTACCCTGGGGACTCTCTACTTCAGGTGCAACTGTTAAAAAAACAGACCTGCCCATGAAATGTCTACAACCAAA

TGAAACATCTAATATGTCTCCTTTTGAAAGTAGAGGGATTCCCAAACCAAGTGGTGTAATTAAGCTCTGGAATTCCCCTTTTGGCTACAATGTTGTAAGT

TCTCAAGATCAAGCAGTTACTGATTCAGTAAGAGCTCAGAATTATCCTGTAACTGATGCCAGTCAACTCCAGATTCTACCAGTGGACAGCATTGGTATGC

CCTCGACTCCTAAATTTACCTATGAATCTTTACCTACTGATTTTGAGGCTAAAACCCATCAAAATCCAAATTAG
Translation
MKALLWLYCVLLFVCYCWAV VPQMSRLSVSSSSVTGNLPPTNSYIDIPWLASMPDNCQGTILTTRLILSTANCLKKS - UNI19786 - SKPLYLDI

SGVNYPESTSHGQRICLHPKFNLNDENDPMKADIGLVILEKPIDGDEIPLSQSPSTSLKSCSKCQYKSCYVYEYQS SSKKLGTSRVKKIDVQLLDFSMC

YPQHSSLEKAVGLCIQSQPREDCW - UNI32266 - VQRASPVLCLLMNHWELVGLIHKTSKICQNPAVIIRTAPYFTWIKQFIKVSKKLLNPTRSLH

CRTLYENEYVPQIRHSHNYFTTLASSDYLLRILQGNVGVSPQTTHTNNVPTIFNFSDLNYLADSYRLFLDKNQTPQPVQQLPVAGLPGKFGQNLIQYQPN

TPPHNIGNLSKSPLSQVISNTTISYNSSKADGDNSLGFAANNTDESFDKIMADIIKQSSPTEDDEEEPENLYEDSMADNYWTENVADLEKYQNLLRTMSE

KPQNQYTTKASLPPNLYLPEGEVPWGLSTSGATVKKTDLPMKCLQPNETSNMSPFESRGIPKPSGVIKLWNSPFGYNVVSSQDQAVTDSVRAQNYPVTDA

SQLQILPVDSIGMPSTPKFTYESLPTDFEAKTHQNPN
Transcript ENSMUST00000033688
Sequence
ACAACACACCTCTTGCCAGTTGAGTCGAAATGAAGGCTCTACTTTGGCTTTACTGTGTTTTGCTTTTTGTTTGCTACTGCTGGGCTG TGCCCCAAATGT

CAAGACTGAGTGTGAGTTCAAGCTCAGTGACTGGAAATCTACCACCAACGAATAGCTACATTGATATACCATGGCTGGCATCTATGCCTGATAATTGCCA

GGGTACTATCCTGACTACAAGGCTGATTCTTTCAACAGCCAACTGTCTGAAGAAATC - UNI19786 - GAAACCGTTATACCTGGACATTTCAGGAG

TAAATTACCCAGAAAGCACTTCACATGGTCAAAGAATCTGCCTCCACCCCAAGTTTAATCTCAACGATGAAAATGATCCAATGAAAGCAGATATTGGCTT

GGTTATTCTTGAAAAGCCTATCGATGGGGATGAAATACCACTATCCCAGTCCCCTAGTACATCCCTGAAGAGCTGTTCTAAGTGCCAATACAAGAGCTGT

TATGTGTATGAATATCAGA GTAGCAAGAAACTTGGAACCAGCAGAGTAAAGAAGATAGATGTGCAGCTGCTAGATTTCTCAATGTGCTACCCCCAACAT

TCCAGTTTAGAGAAGGCCGTGGGCTTGTGTATTCAGAGTCAACCACGGGAAGACTGCTGG - UNI32266 - GTACAGAGAGCCAGTCCTGTTCTATG

TCTCCTAATGAACCACTGGGAACTAGTGGGCCTCATACATAAGACTTCAAAGATATGTCAAAATCCCGCAGTCATCATTAGAACAGCTCCTTACTTTACC

TGGATAAAACAATTCATCAAG - UNI32266 - GCAGGACCTTTAAAGCCAAGATCTTCTCCCAGATCAAGTAGATGTTCTGGTGCTTTGCTTTTGAA

TTGCAGTAAGTGGAAGAAGTATATAGGGAAACAGGCAACTTACTAA
Translation
MKALLWLYCVLLFVCYCWAV VPQMSRLSVSSSSVTGNLPPTNSYIDIPWLASMPDNCQGTILTTRLILSTANCLKKS - UNI19786 - SKPLYLDI

SGVNYPESTSHGQRICLHPKFNLNDENDPMKADIGLVILEKPIDGDEIPLSQSPSTSLKSCSKCQYKSCYVYEYQS SSKKLGTSRVKKIDVQLLDFSMC

YPQHSSLEKAVGLCIQSQPREDCW - UNI32266 - VQRASPVLCLLMNHWELVGLIHKTSKICQNPAVIIRTAPYFTWIKQFIK - UNI32266 -

 AGPLKPRSSPRSSRCSGALLLNCSKWKKYIGKQATY

For any suggestions or comments, please send an email to unitrap@crg.es