Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031343 (Gabra3)
Chromosomal location
Chr X: 69678020 - 69902073 (-)
Description
gamma-aminobutyric acid (GABA-A) receptor, subunit alpha 3 Gene [Source:MGI (curated);Acc:Gabra3-002]
Human Ortholog
not available
Omim not available
UniTrap UNI38085
Vector Insertion
Chr X: 69798015 - 69901494
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35810
Vector Insertion
Chr X: 69678019 - 69690726
Public Clones IST14184A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055966
Sequence
GCTAGCTAGCTAGCTAGCAAAGCAGAGAGACAGACTGAGATAGGGACTAGGAGAAATATCTAGAGAAAGAAAAGAAGCCAGGCTCTATCAGGGCTTAGCC

TCCAACTTGTTTCTCCTCTCTGCTTCGGGGAAGTGACTGTGACACTCG ATCTCACAGGTCTCTTCAAGTTGCTGTCTAAGAAGATGATAATCACACAAA

TGTGGCACTTTTATGTGACCAGAGTTGTACTTCTTCTCCTGATTAGTATTCTCCCTGGAACCACTAGCCAAGGGGAATCAAGACGACAAGAACCTGGGGA

CTTTGTGAAACAAGATATTGGAGG ACTCTCTCCCAAGCATGCCCCAGATATTCCTGACGATAGTACAGATAATATCACTATCTTCACTAGAATCTTGGA

TCGGCTTTTGGATGGCTATGATAACCGGCTTCGACCTGGACTTGGAG ATGCAGTGACTGAAGTGAAGACAGACATCTATGTGACCAGTTTTGGCCCTGT

GTCAGACACTGATATG GAATATACTATTGATGTATTTTTTAGACAGACATGGCATGATGAAAGACTGAAATTTGATGGACCAATGAAGATCCTTCCACT

GAACAATCTTCTGGCTAGTAAGATATGGACTCCTGATACCTTCTTCCACAATGGTAAAAAATCAGTGGCTCACAATATGACCACACCCAACAAGCTGCTC

AGACTGGTAGATAATGGGACCCTCCTCTATACAATGAG GTTAACAATACACGCTGAATGCCCCATGCATTTGGAAGATTTCCCCATGGATGTGCATGCC

TGCCCACTGAAGTTTGGAAGCT ATGCCTATACCAAAGCTGAAGTAATTTATTCTTGGACTCTTGGGAAGAACAAATCTGTGGAAGTAGCACAGGATGGC

TCACGCCTGAATCAGTATGACTTGCTTGGCCATGTTGTTGGGACAGAGATAATCCGGTCTAGTACAG GAGAATATGTCGTCATGACAACCCACTTTCAT

CTGAAGAGAAAAATTGGCTACTTTGTCATCCAGACCTACTTGCCATGTATCATGACTGTCATTCTGTCACAAGTGTCTTTCTGGCTTAATAGAGAATCTG

TCCCTGCCCGCACAGTCTTTG - UNI35810 - GTGTCACCACTGTTCTCACCATGACCACCTTGAGTATCAGTGCCAGAAACTCTTTACCTAAAGTG

GCATACGCGACGGCCATGGACTGGTTCATAGCCGTCTGTTATGCCTTTGTATTTTCTGCACTGATTGAATTTGCTACTGTCAACTACTTCACCAAGCGGA

GTTGGGCTTGGGAAGGCAAGAAGGTACCAGAGGCCCTGGAGATGAAG - UNI35810 - AAGAAAACACCAGCAGCTCCAACAAAGAAAAACACCACC

TTCAACATAGTGGGTACCACCTATCCTATCAATCTGGCCAAGGATACTGAGTTCTCCACCATCTCCAAGTCTGCTGCTGCTCCCAGTGCTTCTTCAACTC

CAACAGCGATTGCTTCACCCAAGGCTACTTATGTGCAAGACAGTCCTGCTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCAT

CATCTTCCCTGTGCTCTTTGCCATATTCAATCTTGTCTATTGGGCTACATATGTGAACCGGGAATCAGCTATCAAGGGCATGATCCGCAAACAGTAGATA

ATAGTGGCAGCACAGCAACCAGAGCACTGTATACCCCAGGAAGCATCCAAACCCGAAACCCCAGGGCTCCCCTCATGTTTCAGGATTCTTTTTAACCCTG

TTCCAAACTGAGTGTAATCACTTTCTCAATTCGTATTCATGAGCCTCAATGAAAATGTAAAACAGAAAAATGACTTGTCCTTTGAACATTGCTTGGATTG

AGCCAAACACTGCCATTTGTCCAGTTTCTCATCTTAGTATGCCAGTCTACCCCAGCTGACCGCACTGCATGTGTTTAATTTCACTCTGCCCACTGGAGAA

AGGACAGGAGACTCTACTTCTAGTGGAAACCTTGGCGGTGTGAGGTCTAGGGTGTTGAGATCCAGGAGCACTGTTGACTGGGGCTTCATTGGATGGTTCT

GACTCACTACAGAGTCGGCTGGGCTATCTCATATAATCTTACTTACCTGATACCCATTAGTGCTTACTAGGCATATGGCCTACCTGGTAGAATGGGAAGA

AGTCTATGGAAACTTCTGAAGTAACCAATAGTTTCTTGCCTTGGAGGTCAGTGGGGGACAATTGATGCTTACCTCTGTCAAACATATGTATATGAGAGAC

AGAGAAAGAGACAGAGAGACAGAAAGACAGAGAGAGAGAGAGAAAACTAGTTGGGTCATTCCAACGTTAGAGCAGTGGGCTCTATTGTAGTTTAAGTCAG

CCCCTCAGGAAAGTAGTGCCTGAATATATGTCTCCTTCAAGAAAGTCCCATTGCTTCAATAATATTGAGCCCTTTATAGCCAGTTGAGTATTGCTTATTT

TGGATTCATGGCTGCCTACAAAATCTTCCAGGAAAAAAATGAACAGACATTTTTGAGTTAAATTAAAATGGTACATGTACAAACAAAATGATCTAGATCA

AATGACTACACAAGAATTGTTCAAAGATGGGGAATATAAGAAACTCACTTTCCTGCCAAAGCAATTAGTCAAATTGTAGATGGAATATGATGGTGGTGGC

TAAAGGCTAAATCTGCCTCAGAAGAAAGGGCCACAAACAGATTGTATATATGGTGTCCTCTTTCAGGCCCAGTCACTTTGTTCCCCATTATGTCAAGGAC

TCCTTACCTGATTTGGATGCCAGTTGTAATGAGGTGTGAATTGTAGAGTCATAGAAATACCTGTACTTATTTTTTGAGTCAGTTAAATCATGAATTTTAT

TACCAATTTTATAATGTATTAGAGGGCATTTGATCTCATGTGTTCTTAAATGTGAACAAAATGAACAGAGGCAATTTTTATAAGGTAGTCTCAGAAGTTT

GAATAATTTGCCTTTACCTCTTACAAATGTCTTTAATAAAGAAATATTCCACACTCATTTCCAATGTGAAGGAATAGCTGAGAAGCTAGGGCCATTTTGA

CCTTAGAACCAGCACAGCCATGGAGGGCCCTCTGGATTATGGAGACAATTTGGACACTACAAAGGTCTTTTAAAAGGTAACAATATATTACCCAAGAAGA

TCACTTCTAGTAGTAATGGCTCAAAGGAGTGAGATTGTTTAGTATAACAGCCTCAGCCACTTTGGATCTGAATAGCTCAACTAGTCCAGCATATCCTTAA

GGTCAAAGGTAAAAGCCACAAATAGCACCACAAGCAGATTCTTCCTGCCCACTCACTGAGCAAGGCTCCTAAGGGGTGTATCATTAGCTGCTGGTTGTCT

TTTCATCCATCTTTCCATTATTCCCTGCTTCCTGCCATTGTTGGGATAATGCATGCCAGTCCCATTATTCTTAAGACTGTGTCTGTAGGTAAACTTATGA

CTAGAAGAGTGTAGTCTTGTGGATGTGTGGGGATGGGGGGTGGGATGGGGGGCTGTCTTAAGGAATTTAGAATGGAAGCCTGATCTTTGCCTCTCTGTAG

AAATTGTGTTTTAAAATGCTTTGGTGCAATGTTTAGCGGCTGTTCATTAAACTCTTTATGAATTG
Translation
 MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGG GLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGD DAVTEVKT

DIYVTSFGPVSDTDM EYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMR RLTIHAECP

MHLEDFPMDVHACPLKFGSY YAYTKAEVIYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTG GEYVVMTTHFHLKRKIGYFVIQTYLPCIM

TVILSQVSFWLNRESVPARTVFG - UNI35810 - GVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWEGKK

VPEALEMK - UNI35810 - KKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAAAPSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKIS

RIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ
Transcript ENSMUST00000114554
Sequence
ATGGAAGGGAGAGAAGAGAGAAAAGGAGGAAGCTCACACTTTGGTCCTGAAGAGAGAAGTAAGCATCTCACAGCGGCTTG TACTGTAGATCTCACAGGT

CTCTTCAAGTTGCTGTCTAAGAAGATGATAATCACACAAATGTGGCACTTTTATGTGACCAGAGTTGTACTTCTTCTCCTGATTAGTATTCTCCCTGGAA

CCACTAGCCAAGGGGAATCAAGACGACAAGAACCTGGGGACTTTGTGAAACAAGATATTGGAGG ACTCTCTCCCAAGCATGCCCCAGATATTCCTGACG

ATAGTACAGATAATATCACTATCTTCACTAGAATCTTGGATCGGCTTTTGGATGGCTATGATAACCGGCTTCGACCTGGACTTGGAG ATGCAGTGACTG

AAGTGAAGACAGACATCTATGTGACCAGTTTTGGCCCTGTGTCAGACACTGATATG GAATATACTATTGATGTATTTTTTAGACAGACATGGCATGATG

AAAGACTGAAATTTGATGGACCAATGAAGATCCTTCCACTGAACAATCTTCTGGCTAGTAAGATATGGACTCCTGATACCTTCTTCCACAATGGTAAAAA

ATCAGTGGCTCACAATATGACCACACCCAACAAGCTGCTCAGACTGGTAGATAATGGGACCCTCCTCTATACAATGAG GTTAACAATACACGCTGAATG

CCCCATGCATTTGGAAGATTTCCCCATGGATGTGCATGCCTGCCCACTGAAGTTTGGAAGCT ATGCCTATACCAAAGCTGAAGTAATTTATTCTTGGAC

TCTTGGGAAGAACAAATCTGTGGAAGTAGCACAGGATGGCTCACGCCTGAATCAGTATGACTTGCTTGGCCATGTTGTTGGGACAGAGATAATCCGGTCT

AGTACAG GAGAATATGTCGTCATGACAACCCACTTTCATCTGAAGAGAAAAATTGGCTACTTTGTCATCCAGACCTACTTGCCATGTATCATGACTGTC

ATTCTGTCACAAGTGTCTTTCTGGCTTAATAGAGAATCTGTCCCTGCCCGCACAGTCTTTG - UNI35810 - GTGTCACCACTGTTCTCACCATGAC

CACCTTGAGTATCAGTGCCAGAAACTCTTTACCTAAAGTGGCATACGCGACGGCCATGGACTGGTTCATAGCCGTCTGTTATGCCTTTGTATTTTCTGCA

CTGATTGAATTTGCTACTGTCAACTACTTCACCAAGCGGAGTTGGGCTTGGGAAGGCAAGAAGGTACCAGAGGCCCTGGAGATGAAG - UNI35810 -

 AAGAAAACACCAGCAGCTCCAACAAAGAAAAACACCACCTTCAACATAGTGGGTACCACCTATCCTATCAATCTGGCCAAGGATACTGAGTTCTCCACC

ATCTCCAAGTCTGCTGCTGCTCCCAGTGCTTCTTCAACTCCAACAGCGATTGCTTCACCCAAGGCTACTTATGTGCAAGACAGTCCTGCTGAGACCAAGA

CCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTCCCTGTGCTCTTTGCCATATTCAATCTTGTCTATTGGGCTACATATGTGAACCG

GGAATCAGCTATCAAGGGCATGATCCGCAAACAGTAGATAATAGTGGCAGCACAGCAACCAGAGCACTGTATACCCCAGGAAGCATCCAAACCCGAAACC

CCAGGGCTCCCCTCATGTTTCAGGATTCTTTTTAACCCTGTTCCAAACTGAGTGTAATCACTTTCTCAATTCGTATTCATGAGCCTCAATGAAAATGTAA

AACAGAAAAATGACTTGTCCTTTGAACATTGCTTGGATTGAGCCAAACACTGCCATTTGTCCAGTTTCTCATCTTAGTATGCCAGTCTACCCCAGCTGAC

CGCACTGCATGTGTTTAATTTCACTCTGCCCACTGGAGAAAGGACAGGAGACTCTACTTCTAGTGGAAACCTTGGCGGTGTGAGGTCTAGGGTGTTGAGA

TCCAGGAGCACTGTTGACTGGGGCTTCATTGGATGGTTCTGACTCACTACAGAGTCGGCTGGGCTATCTCATATAATCTTACTTACCTGATACCCATTAG

TGCTTACTAGGCATATGGCCTACCTGGTAGAATGGGAAGAAGTCTATGGAAACTTCTGAAGTAACCAATAGTTTCTTGCCTTGGAGGTCAGTGGGGGACA

ATTGATGCTTACCTCTGTCAAACATATGTATATGAGAGACAGAGAAAGAGACAGAGAGACAGAAAGACAGAGAGAGAGAGAGAAAACTAGTTGGGTCATT

CCAACGTTAGAGCAGTGGGCTCTATTGTAGTTTAAGTCAGCCCCTCAGGAAAGTAGTGCCTGAATATATGTCTCCTTCAAGAAAGTCCCATTGCTTCAAT

AATATTGAGCCCTTTATAGCCAGTTGAGTATTGCTTATTTTGGATTCATGGCTGCCTACAAAATCTTCCAGGAAAAAAATGAACAGACATTTTTGAGTTA

AATTAAAATGGTACATGTACAAACAAAATGATCTAGATCAAATGACTACACAAGAATTGTTCAAAGATGGGGAATATAAGAAACTCACTTTCCTGCCAAA

GCAATTAGTCAAATTGTAGATGGAATATGATGGTGGTGGCTAAAGGCTAAATCTGCCTCAGAAGAAAGGGCCACAAACAGATTGTATATATGGTGTCCTC

TTTCAGGCCCAGTCACTTTGTTCCCCATTATGTCAAGGACTCCTTACCTGATTTGGATGCCAGTTGTAATGAGGTGTGAATTGTAGAGTCATAGAAATAC

CTGTACTTATTTTTTGAGTCAGTTAAATCATGAATTTTATTACCAATTTTATAATGTATTAGAGGGCATTTGATCTCATGTGTTCTTAAATGTGAACAAA

ATGAACAGAGGCAATTTTTATAAGGTAGTCTCAGAAGTTTGAATAATTTGCCTTTACCTCTTACAAATGTCTTTAATAAAGAAATATTCCACACTCATTT

CCAATGTGAAGGAATAGCTGAGAAGCTAGGGCCATTTTGACCTTAGAACCAGCACAGCCATGGAGGGCCCTCTGGATTATGGAGACAATTTGGACACTAC

AAAGGTCTTTTAAAAGGTAACAATATATTACCCAAGAAGATCACTTCTAGTAGTAATGGCTCAAAGGAGTGAGATTGTTTAGTATAACAGCCTCAGCCAC

TTTGGATCTGAATAGCTCAACTAGTCCAGCATATCCTTAAGGTCAAAGGTAAAAGCCACAAATAGCACCACAAGCAGATTCTTCCTGCCCACTCACTGAG

CAAGGCTCCTAAGGGGTGTATCATTAGCTGCTGGTTGTCTTTTCATCCATCTTTCCATTATTCCCTGCTTCCTGCCATTGTTGGGATAATGCATGCCAGT

CCCATTATTCTTAAGACTGTGTCTGTAGGTAAACTTATGACTAGAAGAGTGTAGTCTTGTGGATGTGTGGGGATGGGGGGTGGGATGGGGGGCTGTCTTA

AGGAATTTAGAATGGAAGCCTGATCTTTGCCTCTCTGTAGAAATTGTGTTTTAAAATGCTTTGGTGCAATGTTTAGCGGCTGTTCATTAAACTCTTTATG

AATTG
Translation
MEGREERKGGSSHFGPEERSKHLTAAC CTVDLTGLFKLLSKKMIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGG GLSPKHAPD

IPDDSTDNITIFTRILDRLLDGYDNRLRPGLGD DAVTEVKTDIYVTSFGPVSDTDM EYTIDVFFRQTWHDERLKFDGPMKILPLNNLLASKIWTPDTF

FHNGKKSVAHNMTTPNKLLRLVDNGTLLYTMR RLTIHAECPMHLEDFPMDVHACPLKFGSY YAYTKAEVIYSWTLGKNKSVEVAQDGSRLNQYDLLGH

VVGTEIIRSSTG GEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFG - UNI35810 - GVTTVLTMTTLSISARNSLPK

VAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWEGKKVPEALEMK - UNI35810 - KKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISK

SAAAPSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVNRESAIKGMIRKQ

For any suggestions or comments, please send an email to unitrap@crg.es