Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031347 (Cetn2)
Chromosomal location
Chr X: 70159043 - 70163673 (-)
Description
centrin 2 Gene [Source:MGI (curated);Acc:Cetn2-001]
RefSeq_dna
NM_019405 
RefSeq_peptide
NP_062278.2 
UniGene
Mm.24643 
MGI
MGI:1347085 
Uniprot/SWISSPROT
Q9R1K9 
Uniprot/SPTREMBL
B1AUQ6 B1AUQ7 B1AUQ8 
Human Ortholog
ENSG00000147400 (CETN2)
Omim not available
UniTrap UNI19618
Vector Insertion
Chr X: 70162196 - 70163224
Public Clones not available
Private Clones OST386021 (lexicon) OST123881 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114550
Sequence
CCTCCTGGCCGCGGCCACCCAGTTAAAGTTTATGCATTGGTGCTAAGAGGTTTACTGTGTTCTGATGGTCGCAAACGCTTTCAGGAGAGGCTGTGAGAAA

GCACGCAG - UNI19618 - GCCTCTAATTTTAAGAAGACAACCATGGCATCCAGTGCCCAGAGAAAAAGGATGAGTCCTAAGCCTGAACTTACTGAA

GACCAGAAACAGGAAATCCGGGAAGCTTTTGATCTCTTTGATGCTGATGGAACTGGAACTATAGACATCAAAGAACTGAAG GTGGCAATGAGGGCCCTG

GGCTTTGAGCCCAAGAAAGAAGAAATTAAGAAAATGATAAGTGAAATTGATAAAGAAGGAACAGGAAAAATGAACTTCAGTGACTTTTTGACAGTGATGA

CTCAGAAAATG TCTGAGAAAGACACTAAAGAAGAAATCCTGAAAGCTTTCAAGTTGTTCGATGATGATGAGACTGGGAAAATATCATTCAAGAATCTTA

AGCGCGTGGCCAAGGAGCTGGGTGAGAACCTGACAGATGAGGAACTGCAG GAAATGATTGATGAAGCTGATCGAGATGGAGATGGTGAGGTCAATGAGC

AAGAGTTCCTGCGCATCATGAAAAAGACCAGCCTCTATTAAGATCAGTGTTTCTTTTTCTACTGCAAGCACATGTGACTAGATTTAGTGCCTGGCATTTT

GTGAAATATGGCTTTTGAAAGCCTCCCTCCCCCAACCTGGGGTAACTTTAGCCATGACCTTGAATCTATTTTTGACTTTTGGAAGTGTTCTTTGATATTA

AGTTCTTTGTACATTTACCTGCTGACTAAATCAACAGGGCAGAACAAGAGCACATAGAGTGGGGAAAAGGGTCTGAAAGTGTGACTGTGGCCACCCCACC

TTCCATTACTTCACCTTGCTCATGCATATCCACTCGACTGAAAACATGCAGTGGCTTCTTAGTTGTCCATGTATCCATGTCACCATAAGCAGTGGTTGTT

CTTAAAGTGGTTTTGGTTTTCATTTGACACCACAGTACAGTTTTCTCTTTTACAAAACCCAATGAGTGCTTGCTGTGGCATTTGGATGTGTGTTAATGTA

TTTGTTTGGTCTTTAAAAAAATAAAACCTTTCTTAATTTAA
Translation
 - UNI19618 - MASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELK VAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMT

QKM SEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQ EMIDEADRDGDGEVNEQEFLRIMKKTSLY
Transcript ENSMUST00000033713
Sequence
TTGTGTGAAGGCCTCTAATTTTAAGAAGACAACCATGGCATCCAGTGCCCAGAGAAAAAGGATGAGTCCTAAGCCTGAACTTACTGAAGACCAGAAACAG

GAAATCCGGGAAGCTTTTGATCTCTTTGATGCTGATGGAACTGGAACTATAGACATCAAAGAACTGAAG GTGGCAATGAGGGCCCTGGGCTTTGAGCCC

AAGAAAGAAGAAATTAAGAAAATGATAAGTGAAATTGATAAAGAAGGAACAGGAAAAATGAACTTCAGTGACTTTTTGACAGTGATGACTCAGAAAATG 

TCTGAGAAAGACACTAAAGAAGAAATCCTGAAAGCTTTCAAGTTGTTCGATGATGATGAGACTGGGAAAATATCATTCAAGAATCTTAAGCGCGTGGCCA

AGGAGCTGGGTGAGAACCTGACAGATGAGGAACTGCAG GAAATGATTGATGAAGCTGATCGAGATGGAGATGGTGAGGTCAATGAGCAAGAGTTCCTGC

GCATCATGAAAAAGACCAGCCTCTATTAAGATCAGTGTTTCTTTTTCTACTGCAAGCACATGTGACTAGATTTAGTGCCTGGCATTTTGTGAAATATGGC

TTTTGAAAGCCTCCCTCCCCCAACCTGGGGTAACTTTAGCCATGACCTTGAATCTATTTTTGACTTTTGGAAGTGTTCTTTGATATTAAGTTCTTTGTAC

ATTTACCTGCTGACTAAATCAACAGGGCAGAACAAGAGCACATAGAGTGGGGAAAAGGGTCTGAAAGTGTGACTGTGGCCACCCCACCTTCCATTACTTC

ACCTTGCTCATGCATATCCACTCGACTGAAAACATGCAGTGGCTTCTTAGTTGTCCATGTATCCATGTCACCATAAGCAGTGGTTGTTCTTAAAGTGGTT

TTGGTTTTCATTTGACACCACAGTACAGTTTTCTCTTTTACAAAACCCAATGAGTGCTTGCTGTGGCATTTGGATGTGTGTTAATGTATTTGTTTGGTCT

TTAAAAAAATAAAACCTTTCTTAATTTAA
Translation
MASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELK VAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKM SEKDTKEEIL

KAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQ EMIDEADRDGDGEVNEQEFLRIMKKTSLY
Transcript ENSMUST00000114551
Sequence
GGCAGAGTCCGTTGGGTGATG - UNI19618 - GCCTCTAATTTTAAGAAGACAACCATGGCATCCAGTGCCCAGAGAAAAAGGATGAGTCCTAAGCC

TGAACTTACTGAAGACCAGAAACAGGAAATCCGGGAAGCTTTTGATCTCTTTGATGCTGATGGAACTGGAACTATAGACATCAAAGAACTGAAG GTGGC

AATGAGGGCCCTGGGCTTTGAGCCCAAGAAAGAAGAAATTAAGAAAATGATAAGTGAAATTGATAAAGAAGGAACAGGAAAAATGAACTTCAGTGACTTT

TTGACAGTGATGACTCAGAAAATG TCTGAGAAAGACACTAAAGAAGAAATCCTGAAAGCTTTCAAGTTGTTCGATGATGATGAGACTGGGAAAATATCA

TTCAAGAATCTTAAGCGCGTGGCCAAGGAGCTGGGTGAGAACCTGACAGATGAGGAACTGCAG GAAATGATTGATGAAGCTGATCGAGATGGAGATGGT

GAGGTCAATGAGCAAGAGTTCCTGCGCATCATGAAAAAGACCAGCCTCTATTAAGATCAGTGTTTCTTTTTCTACTGCAAGCACATGTGACTAGATTTAG

TGCCTGGCATTTTGTGAAATATGGCTTTTGAAAGCCTCCCTCCCCCAACCTGGGGTAACTTTAGCCATGACCTTGAATCTATTTTTGACTTTTGGAAGTG

TTCTTTGATATTAAGTTCTTTGTACATTTACCTGCTGACTAAATCAACAGGGCAGAACAAGAGCACATAGAGTGGGGAAAAGGGTCTGAAAGTGTGACTG

TGGCCACCCCACCTTCCATTACTTCACCTTGCTCATGCATATCCACTCGACTGAAAACATGCAGTGGCTTCTTAGTTGTCCATGTATCCATGTCACCATA

AGCAGTGGTTGTTCTTAAAGTGGTTTTGGTTTTCATTTGACACCACAGTACAGTTTTCTCTTTTACAAAACCCAATGAGTGCTTGCTGTGGCATTTGGAT

GTGTGTTAATGTATTTGTTTGGTCTTTAAAAAAATAAAACCTTTCTTAATTT
Translation
M - UNI19618 - ASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELK VAMRALGFEPKKEEIKKMISEIDKEGTGKMN

FSDFLTVMTQKM SEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQ EMIDEADRDGDGEVNEQEFLRIMKKTSLY

For any suggestions or comments, please send an email to unitrap@crg.es