Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031351 (Zfp185)
Chromosomal location
Chr X: 70232721 - 70276882 (+)
Description
zinc finger protein 185 Gene [Source:MGI (curated);Acc:Zfp185-001]
RefSeq_peptide
NP_033575.3 NP_001102513.1 
UniGene
Mm.401660 Mm.1161 
MGI
MGI:108095 
Uniprot/SWISSPROT
Q62394 
Uniprot/SPTREMBL
A2BI38 Q8C875 Q9CRR9 Q9JJQ5 Q8CHR0 Q9JJR3 A2BI37 
Human Ortholog
ENSG00000147394 (ZNF185)
Omim not available
UniTrap UNI23113
Vector Insertion
Chr X: 70242373 - 70242452
Public Clones not available
Private Clones OST275996 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15167
Vector Insertion
Chr X: 70248799 - 70257778
Public Clones PST11827-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033718
Sequence
TCAGAGACGAATCAAATGCCAG GTCTCCAAACGCAAGGGCTCCAGCTGGTTACATAATCCG GGGAGTGTTCACCCGAACAATAGATAGCTCTTCTCAC

TCCCAGCATCGCCCCTCTAAGACCAACGGAGCTCCAAGAAG TGCTTCTGGGCAGCTGGGAGCAGCTAATTCTGGTCATCCTCTTCAGTCGTCTGGCTAT

AAGATGACTACGGAAGATTATAAGAAACT AGCACCGTACAACATCAGGCGCAGCTCCATATCAGGGACTGAGGAAGAGGAGGTGCCATTCACCCCAGAT

GAGCAGAAACGGAG GTCCCAGGCTGCACTTGGTGTTCTGAGGAAGACAGCCCCCCGGGAGCACTCTTACGTCCTCTCAGCAGCTAAGAAGACCACTAG 

TCCGACCCAGGAGCTGCAGTCGCCATTCCTTGCAAAAAG GGTTGATGTGGTAGATGAGGACGTCCTTCCTGAGAAAAACCAGGAACCACCTGCTCTGGC

AAGACCTGATCCTGGCCGAAGCAG CTCGACAACCGAGAAGATTGCCCATCGGCAGATTACACCCCCCACAGCAGAACTCCACCTGGTGGCCCCAGACCT

GGAAGCCCTGAG - UNI15167 - CACTCCAGATTCTTGTGAGGAGAACAATGCAGCCCCCAAGATCATCAAGGAAATACCTGGCACCCTACAAGATG

GACAAAGTGACCCAACTGTGGCTTCTCAGCAACTTGCAGATCTCAGCATCCTAGAGCCACAGGGTAGCCCCAGTGGAGCCGAGCAGCAAATCAAAGCCGA

GGACTGTACTAACAT GCTGATGAGCCCTTCAAGCTGCATGGTCACTGTTACCATCTCTGACACCTCTGAACAATCTCAATTGTGTGTTCCTGGTGTCTC

AAGCAAGGTGGACTCCAGCTCAACTAT CAAAGGGATTCTCTTCGTGAAGGAGTACATGAATACCAGTGAAGTGTCTTCTGGGAAGCCAGTGTCTTCACA

CTGTGACAG TCCCAGCAGCATTGAAGACTCATTGGATCTGGCAAAGAAAGCCCCACATGAAGGTACTCCTTCTGAGAG ACCAACCGAAGGGGTCTGTA

CTTACTGTAGCCATGAGATCCAAGATTGTCCGAAGATTACCCTTGAACATCTTGGCATCTGCTGCCATGAGTATTGTTTTAAG TGCGGGATTTGCAATA

AACCGATGGGTGATCTCCTAGATCAGATCTTCATTCACCGTGACACCATCCACTGTGGGAAATGCTATGAGAAGCTCTTCTAG GCTGAACAGAAGCTGA

TGATCCCCAGCTGTATTTGGCTGTCCAGTTGACCCAAATTGTTGGCTCCTCGTCACTTACATCCTCCATGGTTCCACTGTACTTCTGCCTACCTTGTGCG

GAAGGAGCATACATCTAAGATTGTGTAGCCATGATGTTATGATTTTGTGTAGCCTTTTATACCTTAGGAATATCTCAGTTCCTTGCTTCCAGGATGAATG

AGTCCACTTTGACCTCCCTGAGACATGTTTTCTAATGAGTGCAGATGACCTAGTATGTTAGACATGGGTACAAGTCTAGGTATCAGCGTATGCAGACTTT

CTGAGGCTTCTGAGAGCCCAAGCCAAAAAACTGTTGACGATCCCTGGTAGGGAAATTACAGGCATTAAATACTAAGGGTTGGCAATAGGCTACTGTTTAG

CTTGTCTATTCACTTTGTGTGTATGTGTGTGTGTGTTTAAATTTCTCACATTTTAAAAATAGTTAATTTTTTGATTGAATTACATAGCAGATTTAAATTA

CCTCCTTCCATTCTCCTTTGGTTTTTCCAGTAAGGTATGTCAGCACATGTTGGAAAGTTTACCCAGGTTTAAATTTGATAAGATACAATATTAGGAGGCT

TCTACCAAAGGGATATCTGTGTCTGTTTGAATTTTGTTAGTTAGTTAAAATCTTTACCCTCAGTATTGCTGAACTTTTATCCTCTGAACAGCTTTTAATG

TGTGTAAATCAGGGTAAAGAAAACAGATACGGTTTCTTGAGACTTCTGTTCCTACTGTGAAATATTTCCCTGAAGCGTAGTGTTAGAAATGGCTTTGAAA

AGTGTGAAATTCACCCCATCTCTGGGCTTCTTGGGTCCCTCCTTGAAACACTACGGTAATTTAATTGCTCCCTTTCCCTCTCCTCCAGAGTCTTTCACCC

AGAGACGAATTTGGCTTATGTAACTTCTCAAAGAAAAGCTTGCTATCCAGTGAAACGTCAAGTAGGCTCTCTGCCCTGATCGTGCAGCATTTTGTGACCT

GTTTTCTAGTCCTGAATCTGTCTCAAACTAACATCAACTTCTAGGTTCCCAGGTACTCAAAACACTACCAGTTGATGTCTGGCACAGCAGAGGCAGGTTC

GTCCCTGCAGTTTGCTAATATGCTGCTCTAAGTCAACCTCACTCTGCTGCCTTTGGGCTCAGCATTAAATTGGAAGCTCCTTGAAAGGAAAAAAATAGTC

CTCAAGACTTGGGAATGCAAAATTGAGGCTTCTTTGTTGGATTGACTTAGAAGATAGCTCTTCACTCTCTGCAGACTTTGAATGGGCTTGTTCTTCCTAC

CAGGTAACCAGAGAAGAACATTCTATTTATTTGACTATTTATCTGTTACCTGAACTCTGAAGGGAAGAAGGAGTACATTGTGCCACACCCCAATACTAAT

TATGAACTAGTTCTTTCTCAAGTTCAGCTCTAGGATGGGACTTAGCAGAGAGTGGCCAATAACATATGTGTGCCAAATGAATTAGTAAGAGAAAACTAAG

TCAGTCCCTTAATTATCTAGGCATTTCAGTGCAGGCCTCATAGACAAGAGTAAAAGGCTCTAAATCGGATGGCTTCCCCACTTAAAGGTGTACTCTGCCA

TTTAAGGAGTTTTAGAAATATAAAATATACTCAAAGACAGCTTGTAAGGCTAGTATTGATTTGAATCCAAAACAGCCCTTTTGTGTCTTAGACACAAAAT

TCTGCAGCTAACAAAGAGAGATGGTTTTGCATTGATTTGCTTCTTTTTAATTGCTTTCCGTTTTTAATTATCCTTGCTTAATCCACATTAATGTACACAA

ATTATAATAAATGTTAAGATGTTACACAGCAGTATTATAACTTCTTTTTTAAACC
Translation
   MTTEDYKKL LAPYNIRRSSISGTEEEEVPFTPDEQKRR RSQAALGVLRKTAPREHSYVLSAAKKTTS SPTQELQSPFLAKR RVDVVDEDVLPE

KNQEPPALARPDPGRSS SSTTEKIAHRQITPPTAELHLVAPDLEALS - UNI15167 - STPDSCEENNAAPKIIKEIPGTLQDGQSDPTVASQQLA

DLSILEPQGSPSGAEQQIKAEDCTNM MLMSPSSCMVTVTISDTSEQSQLCVPGVSSKVDSSSTI IKGILFVKEYMNTSEVSSGKPVSSHCDS SPSSI

EDSLDLAKKAPHEGTPSER RPTEGVCTYCSHEIQDCPKITLEHLGICCHEYCFK CGICNKPMGDLLDQIFIHRDTIHCGKCYEKLF 
Transcript ENSMUST00000114543
Sequence
CGCGCGCTTCCCACTGCGTACCGCTTCCCGCGCCCGCTGACGCGGCCCGGCTGGGTTCAGTGCTGCCCACCCGAGGGAGCCCGCGCACCACGCCTGTCCG

ACCCTCTGCCCGTCACACAAGCCGGGCACCTGTACCAG - UNI23113 - GAGCTCACTGAATCCACTAATTAAAGAGCTGAAAGATAAACATCATGA

GTATTTCTTCCTTAGGAAGTATTGGGAAAG - UNI23113 - GGAGAACTGTACCATCTGGTGAAGAGGAGCGCAATAATATCCTAAGACAGATGAAA

GTACGGACTACACTAAAGGGTGACCAGAGCTGGATCACCAAGCATGATGACTCTGAGGATCATACCAT AGAGCCACTCTCACGTCACAACCGAGCCACA

TCCTTCTCATCAGTCAGAGACGAATCAAATGCCAG GTCTCCAAACGCAAGGGCTCCAGCTGGTTACATAATCCG GGGAGTGTTCACCCGAACAATAGA

TAGCTCTTCTCACTCCCAGCATCGCCCCTCTAAGACCAACGGAGCTCCAAGAAG TGCTTCTGGGCAGCTGGGAGCAGCTAATTCTGGTCATCCTCTTCA

GTCGTCTGGCTATAAGATGACTACGGAAGATTATAAGAAACT AGCACCGTACAACATCAGGCGCAGCTCCATATCAGGGACTGAGGAAGAGGAGGTGCC

ATTCACCCCAGATGAGCAGAAACGGAG GTCCCAGGCTGCACTTGGTGTTCTGAGGAAGACAGCCCCCCGGGAGCACTCTTACGTCCTCTCAGCAGCTAA

GAAGACCACTAG CAGTCCGACCCAGGAGCTGCAGTCGCCATTCCTTGCAAAAAG GGTTGATGTGGTAGATGAGGACGTCCTTCCTGAGAAAAACCAGG

AACCACCTGCTCTGGCAAGACCTGATCCTGGCCGAAGCAG CTCGACAACCGAGAAGATTGCCCATCGGCAGATTACACCCCCCACAGCAGAACTCCACC

TGGTGGCCCCAGACCTGGAAGCCCTGAG - UNI15167 - CACTCCAGATTCTTGTGAGGAGAACAATGCAGCCCCCAAGATCATCAAGGAAATACCT

GGCACCCTACAAGATGGACAAAGTGACCCAACTGTGGCTTCTCAGCAACTTGCAGATCTCAGCATCCTAGAGCCACAGGGTAGCCCCAGTGGAGCCGAGC

AGCAAATCAAAGCCGAGGACTGTACTAACAT GCTGATGAGCCCTTCAAGCTGCATGGTCACTGTTACCATCTCTGACACCTCTGAACAATCTCAATTGT

GTGTTCCTGGTGTCTCAAGCAAGGTGGACTCCAGCTCAACTAT CAAAGGGATTCTCTTCGTGAAGGAGTACATGAATACCAGTGAAGTGTCTTCTGGGA

AGCCAGTGTCTTCACACTGTGACAG TCCCAGCAGCATTGAAGACTCATTGGATCTGGCAAAGAAAGCCCCACATGAAGGTACTCCTTCTGAGAG ACCA

ACCGAAGGGGTCTGTACTTACTGTAGCCATGAGATCCAAGATTGTCCGAAGATTACCCTTGAACATCTTGGCATCTGCTGCCATGAGTATTGTTTTAAG 

TGCGGGATTTGCAATAAACCGATGGGTGATCTCCTAGATCAGATCTTCATTCACCGTGACACCATCCACTGTGGGAAATGCTATGAGAAGCTCTTCTAG 

GCTGAACAGAAGCTGATGATCCCCAGCTGTATTTGGCTGTCCAGTTGACCCAAATTGTTGGCTCCTCGTCACTTACATCCTCCATGGTTCCACTGTACTT

CTGCCTACCTTGTGCGGAAGGAGCATACATCTAAGATTGTGTAGCCATGATGTTATGATTTTGTGTAGCCTTTTATACCTTAGGAATATCTCAGTTCCTT

GCTTCCAGGATGAATGAGTCCACTTTGACCTCCCTGAGACATGTTTTCTAATGAGTGCAGATGACCTAGTATGTTAGACATGGGTACAAGTCTAGGTATC

AGCGTATGCAGACTTTCTGAGGCTTCTGAGAGCCCAAGCCAAAAAACTGTTGACGATCCCTGGTAGGGAAATTACAGGCATTAAATACTAAGGGTTGGCA

ATAGGCTACTGTTTAGCTTGTCTATTCACTTTGTGTGTATGTGTGTGTGTGTTTAAATTTCTCACATTTTAAAAATAGTTAATTTTTTGATTGAATTACA

TAGCAGATTTAAATTACCTCCTTCCATTCTCCTTTGGTTTTTCCAGTAAGGTATGTCAGCACATGTTGGAAAGTTTACCCAGGTTTAAATTTGATAAGAT

ACAATATTAGGAGGCTTCTACCAAAGGGATATCTGTGTCTGTTTGAATTTTGTTAGTTAGTTAAAATCTTTACCCTCAGTATTGCTGAACTTTTATCCTC

TGAACAGCTTTTAATGTGTGTAAATCAGGGTAAAGAAAACAGATACGGTTTCTTGAGACTTCTGTTCCTACTGTGAAATATTTCCCTGAAGCGTAGTGTT

AGAAATGGCTTTGAAAAGTGTGAAATTCACCCCATCTCTGGGCTTCTTGGGTCCCTCCTTGAAACACTACGGTAATTTAATTGCTCCCTTTCCCTCTCCT

CCAGAGTCTTTCACCCAGAGACGAATTTGGCTTATGTAACTTCTCAAAGAAAAGCTTGCTATCCAGTGAAACGTCAAGTAGGCTCTCTGCCCTGATCGTG

CAGCATTTTGTGACCTGTTTTCTAGTCCTGAATCTGTCTCAAACTAACATCAACTTCTAGGTTCCCAGGTACTCAAAACACTACCAGTTGATGTCTGGCA

CAGCAGAGGCAGGTTCGTCCCTGCAGTTTGCTAATATGCTGCTCTAAGTCAACCTCACTCTGCTGCCTTTGGGCTCAGCATTAAATTGGAAGCTCCTTGA

AAGGAAAAAAATAGTCCTCAAGACTTGGGAATGCAAAATTGAGGCTTCTTTGTTGGATTGACTTAGAAGATAGCTCTTCACTCTCTGCAGACTTTGAATG

GGCTTGTTCTTCCTACCAGGTAACCAGAGAAGAACATTCTATTTATTTGACTATTTATCTGTTACCTGAACTCTGAAGGGAAGAAGGAGTACATTGTGCC

ACACCCCAATACTAATTATGAACTAGTTCTTTCTCAAGTTCAGCTCTAGGATGGGACTTAGCAGAGAGTGGCCAATAACATATGTGTGCCAAATGAATTA

GTAAGAGAAAACTAAGTCAGTCCCTTAATTATCTAGGCATTTCAGTGCAGGCCTCATAGACAAGAGTAAAAGGCTCTAAATCGGATGGCTTCCCCACTTA

AAGGTGTACTCTGCCATTTAAGGAGTTTTAGAAATATAAAATATACTCAAAGACAGCTTGTAAGGCTAGTATTGATTTGAATCCAAAACAGCCCTTTTGT

GTCTTAGACACAAAATTCTGCAGCTAACAAAGAGAGATGGTTTTGCATTGATTTGCTTCTTTTTAATTGCTTTCCGTTTTTAATTATCCTTGCTTAATCC

ACATTAATGTACACAAATTATAATAAATGTTAAGATGTTAC
Translation
 - UNI23113 -  - UNI23113 -     MTTEDYKKL LAPYNIRRSSISGTEEEEVPFTPDEQKRR RSQAALGVLRKTAPREHSYVLSAAKKTT

S SSPTQELQSPFLAKR RVDVVDEDVLPEKNQEPPALARPDPGRSS SSTTEKIAHRQITPPTAELHLVAPDLEALS - UNI15167 - STPDSCEE

NNAAPKIIKEIPGTLQDGQSDPTVASQQLADLSILEPQGSPSGAEQQIKAEDCTNM MLMSPSSCMVTVTISDTSEQSQLCVPGVSSKVDSSSTI IKGI

LFVKEYMNTSEVSSGKPVSSHCDS SPSSIEDSLDLAKKAPHEGTPSER RPTEGVCTYCSHEIQDCPKITLEHLGICCHEYCFK CGICNKPMGDLLDQ

IFIHRDTIHCGKCYEKLF 
Transcript ENSMUST00000114546
Sequence
CGCGCGCTTCCCACTGCGTACCGCTTCCCGCGCCCGCTGACGCGGCCCGGCTGGGTTCAGTGCTGCCCACCCGAGGGAGCCCGCGCACCACGCCTGTCCG

ACCCTCTGCCCGTCACACAAGCCGGGCACCTGTACCAG - UNI23113 - GAGCTCACTGAATCCACTAATTAAAGAGCTGAAAGATAAACATCATGA

GTATTTCTTCCTTAGGAAGTATTGGGAAAG - UNI23113 - GGAGAACTGTACCATCTGGTGAAGAGGAGCGCAATAATATCCTAAGACAGATGAAA

GTACGGACTACACTAAAGGGTGACCAGAGCTGGATCACCAAGCATGATGACTCTGAGGATCATACCAT AGAGCCACTCTCACGTCACAACCGAGCCACA

TCCTTCTCATCAGTCAGAGACGAATCAAATGCCAG GTCTCCAAACGCAAGGGCTCCAGCTGGTTACATAATCCG GGGAGTGTTCACCCGAACAATAGA

TAGCTCTTCTCACTCCCAGCATCGCCCCTCTAAGACCAACGGAGCTCCAAGAAG TGCTTCTGGGCAGCTGGGAGCAGCTAATTCTGGTCATCCTCTTCA

GTCGTCTGGCTATAAGATGACTACGGAAGATTATAAGAAACT AGCACCGTACAACATCAGGCGCAGCTCCATATCAGGGACTGAGGAAGAGGAGGTGCC

ATTCACCCCAGATGAGCAGAAACGGAG GTCCCAGGCTGCACTTGGTGTTCTGAGGAAGACAGCCCCCCGGGAGCACTCTTACGTCCTCTCAGCAGCTAA

GAAGACCACTAG TCCGACCCAGGAGCTGCAGTCGCCATTCCTTGCAAAAAG GGTTGATGTGGTAGATGAGGACGTCCTTCCTGAGAAAAACCAGGAAC

CACCTGCTCTGGCAAGACCTGATCCTGGCCGAAGCAG CTCGACAACCGAGAAGATTGCCCATCGGCAGATTACACCCCCCACAGCAGAACTCCACCTGG

TGGCCCCAGACCTGGAAGCCCTGAG - UNI15167 - CACTCCAGATTCTTGTGAGGAGAACAATGCAGCCCCCAAGATCATCAAGGAAATACCTGGC

ACCCTACAAGATGGACAAAGTGACCCAACTGTGGCTTCTCAGCAACTTGCAGATCTCAGCATCCTAGAGCCACAGGGTAGCCCCAGTGGAGCCGAGCAGC

AAATCAAAGCCGAGGACTGTACTAACAT GCTGATGAGCCCTTCAAGCTGCATGGTCACTGTTACCATCTCTGACACCTCTGAACAATCTCAATTGTGTG

TTCCTGGTGTCTCAAGCAAGGTGGACTCCAGCTCAACTAT CAAAGGGATTCTCTTCGTGAAGGAGTACATGAATACCAGTGAAGTGTCTTCTGGGAAGC

CAGTGTCTTCACACTGTGACAG TCCCAGCAGCATTGAAGACTCATTGGATCTGGCAAAGAAAGCCCCACATGAAGGTACTCCTTCTGAGAG ACCAACC

GAAGGGGTCTGTACTTACTGTAGCCATGAGATCCAAGATTGTCCGAAGATTACCCTTGAACATCTTGGCATCTGCTGCCATGAGTATTGTTTTAAG TGC

GGGATTTGCAATAAACCGATGGGTGATCTCCTAGATCAGATCTTCATTCACCGTGACACCATCCACTGTGGGAAATGCTATGAGAAGCTCTTCTAG GCT

GAACAGAAGCTGATGATCCCCAGCTGTATTTGGCTGTCCAGTTGACCCAAATTGTTGGCTCCTCGTCACTTACATCCTCCATGGTTCCACTGTACTTCTG

CCTACCTTGTGCGGAAGGAGCATACATCTAAGATTGTGTAGCCATGATGTTATGATTTTGTGTAGCCTTTTATACCTTAGGAATATCTCAGTTCCTTGCT

TCCAGGATGAATGAGTCCACTTTGACCTCCCTGAGACATGTTTTCTAATGAGTGCAGATGACCTAGTATGTTAGACATGGGTACAAGTCTAGGTATCAGC

GTATGCAGACTTTCTGAGGCTTCTGAGAGCCCAAGCCAAAAAACTGTTGACGATCCCTGGTAGGGAAATTACAGGCATTAAATACTAAGGGTTGGCAATA

GGCTACTGTTTAGCTTGTCTATTCACTTTGTGTGTATGTGTGTGTGTGTTTAAATTTCTCACATTTTAAAAATAGTTAATTTTTTGATTGAATTACATAG

CAGATTTAAATTACCTCCTTCCATTCTCCTTTGGTTTTTCCAGTAAGGTATGTCAGCACATGTTGGAAAGTTTACCCAGGTTTAAATTTGATAAGATACA

ATATTAGGAGGCTTCTACCAAAGGGATATCTGTGTCTGTTTGAATTTTGTTAGTTAGTTAAAATCTTTACCCTCAGTATTGCTGAACTTTTATCCTCTGA

ACAGCTTTTAATGTGTGTAAATCAGGGTAAAGAAAACAGATACGGTTTCTTGAGACTTCTGTTCCTACTGTGAAATATTTCCCTGAAGCGTAGTGTTAGA

AATGGCTTTGAAAAGTGTGAAATTCACCCCATCTCTGGGCTTCTTGGGTCCCTCCTTGAAACACTACGGTAATTTAATTGCTCCCTTTCCCTCTCCTCCA

GAGTCTTTCACCCAGAGACGAATTTGGCTTATGTAACTTCTCAAAGAAAAGCTTGCTATCCAGTGAAACGTCAAGTAGGCTCTCTGCCCTGATCGTGCAG

CATTTTGTGACCTGTTTTCTAGTCCTGAATCTGTCTCAAACTAACATCAACTTCTAGGTTCCCAGGTACTCAAAACACTACCAGTTGATGTCTGGCACAG

CAGAGGCAGGTTCGTCCCTGCAGTTTGCTAATATGCTGCTCTAAGTCAACCTCACTCTGCTGCCTTTGGGCTCAGCATTAAATTGGAAGCTCCTTGAAAG

GAAAAAAATAGTCCTCAAGACTTGGGAATGCAAAATTGAGGCTTCTTTGTTGGATTGACTTAGAAGATAGCTCTTCACTCTCTGCAGACTTTGAATGGGC

TTGTTCTTCCTACCAGGTAACCAGAGAAGAACATTCTATTTATTTGACTATTTATCTGTTACCTGAACTCTGAAGGGAAGAAGGAGTACATTGTGCCACA

CCCCAATACTAATTATGAACTAGTTCTTTCTCAAGTTCAGCTCTAGGATGGGACTTAGCAGAGAGTGGCCAATAACATATGTGTGCCAAATGAATTAGTA

AGAGAAAACTAAGTCAGTCCCTTAATTATCTAGGCATTTCAGTGCAGGCCTCATAGACAAGAGTAAAAGGCTCTAAATCGGATGGCTTCCCCACTTAAAG

GTGTACTCTGCCATTTAAGGAGTTTTAGAAATATAAAATATACTCAAAGACAGCTTGTAAGGCTAGTATTGATTTGAATCCAAAACAGCCCTTTTGTGTC

TTAGACACAAAATTCTGCAGCTAACAAAGAGAGATGGTTTTGCATTGATTTGCTTCTTTTTAATTGCTTTCCGTTTTTAATTATCCTTGCTTAATCCACA

TTAATGTACACAAATTATAATAAATGTTAAGATGTTAC
Translation
 - UNI23113 - MSISSLGSIGKG - UNI23113 - GRTVPSGEEERNNILRQMKVRTTLKGDQSWITKHDDSEDHTI IEPLSRHNRATSFSSVR

DESNAR RSPNARAPAGYIIR RGVFTRTIDSSSHSQHRPSKTNGAPRS SASGQLGAANSGHPLQSSGYKMTTEDYKKL LAPYNIRRSSISGTEEEEV

PFTPDEQKRR RSQAALGVLRKTAPREHSYVLSAAKKTTS SPTQELQSPFLAKR RVDVVDEDVLPEKNQEPPALARPDPGRSS SSTTEKIAHRQITP

PTAELHLVAPDLEALS - UNI15167 - STPDSCEENNAAPKIIKEIPGTLQDGQSDPTVASQQLADLSILEPQGSPSGAEQQIKAEDCTNM MLMSP

SSCMVTVTISDTSEQSQLCVPGVSSKVDSSSTI IKGILFVKEYMNTSEVSSGKPVSSHCDS SPSSIEDSLDLAKKAPHEGTPSER RPTEGVCTYCSH

EIQDCPKITLEHLGICCHEYCFK CGICNKPMGDLLDQIFIHRDTIHCGKCYEKLF 

For any suggestions or comments, please send an email to unitrap@crg.es