Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031378 (Abcd1)
Chromosomal location
Chr X: 70961936 - 70983869 (+)
Description
ATP-binding cassette, sub-family D (ALD), member 1 Gene [Source:MGI (curated);Acc:Abcd1-001]
RefSeq_dna
NM_007435 
RefSeq_peptide
NP_031461.1 
UniGene
Mm.365 Mm.474653 
MGI
MGI:1349215 
Uniprot/SWISSPROT
P48410 
Uniprot/SPTREMBL
A2ALN0 A2ALM9 
Human Ortholog
ENSG00000214330 (AC127391.4-202)
Omim 300100 - ADRENOLEUKODYSTROPHY  300475 - CONTIGUOUS ABCD1/DXS1375E DELETION SYNDROME  
UniTrap UNI33267
Vector Insertion
Chr X: 70963270 - 70966252
Public Clones IST12547H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31887
Vector Insertion
Chr X: 70966434 - 70974322
Public Clones IST14906H1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18684
Vector Insertion
Chr X: 70976772 - 70979347
Public Clones not available
Private Clones OST417887 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36333
Vector Insertion
Chr X: 70982214 - 70982441
Public Clones IST11418D9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114461
Sequence
GGCGTAGACGCTGTCGTTACTGCCGGGCTGCTCAGCGGACAAACACGCCTGGTGCCCCGGGGAGGGGCGTCACGGGGGGTGGGGGGGGAGGAGCAGTAAG

AGGAGGGAGGTGGAAGGAAAGACACAGCCTCTCTCCTTAAGACCTCTCGAGGCTCTGACCTCAGGGGCTAAGGGGACAGTCTGTAGAGGGAAGCCAGTTC

CTCCACCCGGGCTGCCTGAAGAGGCCACGACCCTGGAGGATTCTAACCCAACCGATCCAGGGGCCCCAGCACCACCGCGAGGGCCTAAAGCAACAGTCTC

AGGGATCACTTCAAGGTTTCCAGTTGCCTAGACAACGAGCCCTGGGTCAGAGCAACAACCCTTCCAGGATCTGTCTGCAACTGTAGCCTCAGGCAGCAGT

TCCAGCCCTCAGCCTGCTCACCAGTCCAGGTGACATGCCGGTGCTCTCCACTCCCCGGCCCTCACGGGTGACCACGCTGAAGCGCACAGCTGTGGTCCTG

GCCCTCACAGCCTATGGAGTCCACAAAATCTACCCTCTAGTACGGCAGTGTCTGACTCCTGCCAGAGGTCCTCAGGTGCCAGCTGGGGAGCCCACTCAAG

AGGCCTCTGGAGCCACCGCAACCAAGGCTGGCATGAACCGGGTATTCCTGCAGCGGCTCTTGGCGCTCCTGAGGCTGCTGTTCCCCCGAGTCTTGTGCCG

GGAAACAGGGCTGCTGGCCCTGCATTCTGCTGCCCTGGTAAGCCGAACTTTCCTGTCTGTGTATGTTGCCCGCCTGGACGGCAGACTGGCCCGCTGCATT

GTACGTAAGGACCCGCGGGCCTTTAGCTGGCAACTGCTGCAGTGGCTCCTCATCGCCCTTCCTGCCACTTTCATCAACAGTGCCATCCGCTACCTAGAGG

GCCAGCTGGCTCTTTCTTTCCGAAGCCGTCTAGTAGCTCATGCCTATGGACTCTACTTCTCCCAACAGACTTACTACCGAGTAAGCAACATGGATGGACG

ACTTCGAAACCCTGATCAGTCTCTGACAGAGGATGTGGTAGCCTTTGCTGCCTCTGTAGCCCACCTTTATTCCAACCTGACCAAGCCACTCCTGGATGTG

GCTGTGACCTCCTACACTCTCCTTCGAGCTGCCCGATCCCGAGGAGCTGGCACAGCCTGGCCCTCAGCCATCGCTGGCCTGGTGGTGTTCCTCACAGCCA

ACGTGCTTCGAGCCTTCTCTCCCAAGTTTGGGGAGCTAGTGGCAGAGGAGGCACGGCGAAAGGGGGAACTGCGCTACATGCACTCTCGAGTGGTGGCCAA

CTCAGAGGAAATTGCCTTCTACGGGGGCCATGAG - UNI33267 - GTGGAACTGGCACTACTACAGCACTCCTATCAAGACCTAGCTTCACAGATCA

ACCTCATCCTGCTTGAGCGCCTATGGTATGTCATGCTGGAACAGTTCCTCATGAAATATGTGTGGAGTGCATCTGGCCTGCTCATGGTAGCTGTCCCCAT

CATCACAGCCACTGGCTATGCAGAGTCAG - UNI31887 - ACTCAGAAGCCATGAAGAAGGCAGCCTTGGAAATGAAGGAAGAGGAGCTGGTTAGTG

AGCGTACAGAAGCTTTCACCATTGCCCGAAACCTCCTCACAGCTGCTGCAGATGCCACCGAAAGGATCATGTCATCTTATAAGGAG GTGACAGAGCTGG

CTGGCTACACAGCCAGGGTGTACGAGATGTTCCAGGTATTTGAAGATGTCAAACACTGTCGTTTTAAGAGGACAGGAGATCTAGAGGAGGCTCAGGCTGG

GCCTGGGGTCATGGTACAGTCTGGTGTCCATGTAGAGGGGCCCCTGAAGATCCAAG GCCAAGTTGTGGATGTGGAGCAGGGGATCATCTGTGAGAACAT

CCCTATCATCACACCCACTGGAGAGGTGGTGGTGGCCAGCCTCAACATCAGGGTAGGTCAAGTAGAGAAGCATTCCTAACCTGAAGTGCTGACCAATCTG

AGCCAAGTAGCTGGGGACAAGGTACACTTCCCAGATTATCTGGTCACCTGCATCTGTAAACCCTAGCCCTTGGCTCACTTAGCTTTGCTAGCAGCAACAT

TGTCCCCAGCCACGTGGAAGATAGGCCAAGGTGAAGCTGAAAGACCAACATATCTCTGACCATGAGACCTGAAGCAATAGTGTAAGTGCTGATAAAAGAG

ATTAACAATTACCAGGGTTGTCCAAGGGTTACCCAAGTGCTCCTAGTCTGATGATTCATCCATCCCACCTGGCTTCCCTGAACTCTGGGCTGGGTACTTG

AAACCAAAGATAAATTGGAGAGTGGAGTGAGTGACCTTAAGAAGTATCCACTGCTTACTGTTGTGACACATACCTTTAATCCCAGCACTTGGGAAGCAGA

GGTGGGTAAATCTCTGTGAGTTTGAGGCCAGTTTGGTCTGCATAGTAAGTTCCAAGACAGCCAGGGCTACACAGAGAAACTCTGTCTTGAAAAACC
Translation
MPVLSTPRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGEPTQEASGATATKAGMNRVFLQRLLALLRLLFPRVLCRETGLLALHSAA

LVSRTFLSVYVARLDGRLARCIVRKDPRAFSWQLLQWLLIALPATFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTYYRVSNMDGRLRNPDQSLTED

VVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE

 - UNI33267 - VELALLQHSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAESD - UNI31887 - DSEAMKKAALE

MKEEELVSERTEAFTIARNLLTAAADATERIMSSYKE VTELAGYTARVYEMFQVFEDVKHCRFKRTGDLEEAQAGPGVMVQSGVHVEGPLKIQG GQVV

DVEQGIICENIPIITPTGEVVVASLNIRVGQVEKHS
Transcript ENSMUST00000002084
Sequence
GGGGACAGTCTGTAGAGGGAAGCCAGTTCCTCCACCCGGGCTGCCTGAAGAGGCCACGACCCTGGAGGATTCTAACCCAACCGATCCAGGGGCCCCAGCA

CCACCGCGAGGGCCTAAAGCAACAGTCTCAGGGATCACTTCAAGGTTTCCAGTTGCCTAGACAACGAGCCCTGGGTCAGAGCAACAACCCTTCCAGGATC

TGTCTGCAACTGTAGCCTCAGGCAGCAGTTCCAGCCCTCAGCCTGCTCACCAGTCCAGGTGACATGCCGGTGCTCTCCACTCCCCGGCCCTCACGGGTGA

CCACGCTGAAGCGCACAGCTGTGGTCCTGGCCCTCACAGCCTATGGAGTCCACAAAATCTACCCTCTAGTACGGCAGTGTCTGACTCCTGCCAGAGGTCC

TCAGGTGCCAGCTGGGGAGCCCACTCAAGAGGCCTCTGGAGCCACCGCAACCAAGGCTGGCATGAACCGGGTATTCCTGCAGCGGCTCTTGGCGCTCCTG

AGGCTGCTGTTCCCCCGAGTCTTGTGCCGGGAAACAGGGCTGCTGGCCCTGCATTCTGCTGCCCTGGTAAGCCGAACTTTCCTGTCTGTGTATGTTGCCC

GCCTGGACGGCAGACTGGCCCGCTGCATTGTACGTAAGGACCCGCGGGCCTTTAGCTGGCAACTGCTGCAGTGGCTCCTCATCGCCCTTCCTGCCACTTT

CATCAACAGTGCCATCCGCTACCTAGAGGGCCAGCTGGCTCTTTCTTTCCGAAGCCGTCTAGTAGCTCATGCCTATGGACTCTACTTCTCCCAACAGACT

TACTACCGAGTAAGCAACATGGATGGACGACTTCGAAACCCTGATCAGTCTCTGACAGAGGATGTGGTAGCCTTTGCTGCCTCTGTAGCCCACCTTTATT

CCAACCTGACCAAGCCACTCCTGGATGTGGCTGTGACCTCCTACACTCTCCTTCGAGCTGCCCGATCCCGAGGAGCTGGCACAGCCTGGCCCTCAGCCAT

CGCTGGCCTGGTGGTGTTCCTCACAGCCAACGTGCTTCGAGCCTTCTCTCCCAAGTTTGGGGAGCTAGTGGCAGAGGAGGCACGGCGAAAGGGGGAACTG

CGCTACATGCACTCTCGAGTGGTGGCCAACTCAGAGGAAATTGCCTTCTACGGGGGCCATGAG - UNI33267 - GTGGAACTGGCACTACTACAGCA

CTCCTATCAAGACCTAGCTTCACAGATCAACCTCATCCTGCTTGAGCGCCTATGGTATGTCATGCTGGAACAGTTCCTCATGAAATATGTGTGGAGTGCA

TCTGGCCTGCTCATGGTAGCTGTCCCCATCATCACAGCCACTGGCTATGCAGAGTCAG - UNI31887 - ACTCAGAAGCCATGAAGAAGGCAGCCTT

GGAAATGAAGGAAGAGGAGCTGGTTAGTGAGCGTACAGAAGCTTTCACCATTGCCCGAAACCTCCTCACAGCTGCTGCAGATGCCACCGAAAGGATCATG

TCATCTTATAAGGAG GTGACAGAGCTGGCTGGCTACACAGCCAGGGTGTACGAGATGTTCCAGGTATTTGAAGATGTCAAACACTGTCGTTTTAAGAGG

ACAGGAGATCTAGAGGAGGCTCAGGCTGGGCCTGGGGTCATGGTACAGTCTGGTGTCCATGTAGAGGGGCCCCTGAAGATCCAAG GCCAAGTTGTGGAT

GTGGAGCAGGGGATCATCTGTGAGAACATCCCTATCATCACACCCACTGGAGAGGTGGTGGTGGCCAGCCTCAACATCAGG - UNI18684 - GTGGA

GGAAGGCATGCACCTGCTCATCACAGGCCCCAATGGCTGTGGCAAGAGTTCTCTGTTCCGAATCCTAGGTGGACTCTGGCCCACATACAGTGGTGTACTC

TATAAGCCCCCACCCCAGCGCATGTTCTATATCCCTCAGAG GCCCTACATGTCCGTGGGCTCCTTGCGTGACCAAGTGATCTATCCCGACTCTGCGGAA

GACATGCGGAGGAAGGGCTGCTCGGAGCAGCAGCTGGAAGCAATCCTGGGCATCGTGCATCTCCGCCACATCCTGCAACGGGAGGGAG GTTGGGAGGCA

GTGTGTGACTGGAAGGACGTCCTGTCTGGAGGTGAGAAGCAGAGGATTGGTATGGCGCGCATGTTCTACCACAG - UNI36333 - GCCCAAGTACGC

CCTCCTGGATGAGTGCACTAGTGCCGTGAGCATTGATGTGGAAGGCAAGATCTTCCAAGCAGCCAAAGATGCTGGTATCGCACTGCTCTCCATCACCCAT

CGACCCTCCCTATG GAAGTACCACACACACTTGCTGCAGTTTGATGGGGAAGGAGGCTGGAAGTTTGAGAAGCTGGATTCTGCTGCCCGCCTGAGCCTG

ACTGAAGAGAAGCAGCGCCTGGAGCAGCAACTGGCGGGCATCCCCAAGATGCAGGGGCGCCTTCAGGAGCTCCGCCAGATCCTTGGCGAAGCTGCAGCTC

CAGTTCAACCCCTGGTCCCAGGAGTCCCCACTTGACTGGGGACCTTATCCCCAGCTCCCACCCTTCTCCAGGCTCTCGGATCACATGAAGGAAGCTCCTC

CCCTCCCCCATTGCCCTGCATGCCTTACCCCTCCCAAGCCTCCTAGCCAATTACCTGCATTCCCTGAAGACCCCACTCTGGGACAGGTAGATATGAATGG

GGACACACTGCATTCCACCTTCACTCTGGGTTCTGCTCCAGGAACTCTGCCCTGTTCAGGGCAGTGTGTCTTTTACTTTTCCCTGGGGAGGGATGGAGGG

TTTGGAAGTCCCCAGTCCTGACTCTATACCAGTATGGCTGAGCCATAGGAAGTAAGCAGGAGCTGCCTCCCTTACTGCCAGCAGCCAGAATGTGTGGCAA

CCCTGGTAGTTGTGGGTTACATCCCTGCCGAAACCCAAATCCTTGTCATTGTTTTGATCCATCCCTTTGTTGCCATCCCCTTGTGTGACCAGCCAATGCC

CCTGTCCCACAGGATACCCCCTGCCATGAAAACAGCCTAATGGGGCCCAGGATTAGACAGGGCCCAAAGTGTGCCCTTCCCCATGGTTACCCAAGAAGGA

CAGAGTTCCTCCTGAGCCATGAAGAGAATATAGCCCTGGCCCTCCCACTCCTCCACCTCTACAACCTAATTTATTGGACTCCCAGTTTATAGTTGTCTAA

ATTGCCAACATGAGTACCCTGCCAGCACAGGAGGTGACTGGGTGGTCCCTTCAATCTACCCAGTCTCTGGTGCCAAACCTGGCCCTTCACCAGCCTATAC

TGCCAGTTGCCACTGGGGGTGCCCTCTGCCAGCTAGGCAGAAGTGAGGGCACCATGTTCCCAGCTCAGTGCCAAAGAGGGGTCACAGGAGGTGCTGTGTC

TGCTAAACCAGCCCTCACCAAGAGGGAGACGCCCCCACACACACACCCTACTGCCATTGTGTGCCTTTCCTGGGCCTTCAGCCCTCCAGCTGGGGTACCC

CCCTCAGTCCTCTCAGTAAAAACCTCTGGAAAGT
Translation
MPVLSTPRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGEPTQEASGATATKAGMNRVFLQRLLALLRLLFPRVLCRETGLLALHSAA

LVSRTFLSVYVARLDGRLARCIVRKDPRAFSWQLLQWLLIALPATFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTYYRVSNMDGRLRNPDQSLTED

VVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGTAWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE

 - UNI33267 - VELALLQHSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAESD - UNI31887 - DSEAMKKAALE

MKEEELVSERTEAFTIARNLLTAAADATERIMSSYKE VTELAGYTARVYEMFQVFEDVKHCRFKRTGDLEEAQAGPGVMVQSGVHVEGPLKIQG GQVV

DVEQGIICENIPIITPTGEVVVASLNIR - UNI18684 - VEEGMHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMFYIPQR RPYMSVGS

LRDQVIYPDSAEDMRRKGCSEQQLEAILGIVHLRHILQREGG GWEAVCDWKDVLSGGEKQRIGMARMFYHR - UNI36333 - RPKYALLDECTSAV

SIDVEGKIFQAAKDAGIALLSITHRPSLW WKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQGRLQELRQILGEAAAPVQPLVPG

VPT

For any suggestions or comments, please send an email to unitrap@crg.es