Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031388 (Ard1)
Chromosomal location
Chr X: 71162226 - 71167227 (-)
Description
ARD1 homolog A, N-acetyltransferase (S. cerevisiae) Gene [Source:MGI (curated);Acc:Ard1-004]
RefSeq_dna
NM_019870 
RefSeq_peptide
NP_063923.1 
MGI
MGI:1915255 
Uniprot/SWISSPROT
Q9QY36 
Uniprot/SPTREMBL
B1AUZ1 B1AUY9 Q3V4D5 Q8R2U5 B1AUY7 B1AUY8 Q540H0 Q684Q8 
Human Ortholog
ENSG00000102030 (ARD1A)
Omim not available
UniTrap UNI17897
Vector Insertion
Chr X: 71166710 - 71167094
Public Clones not available
Private Clones OST434103 (lexicon) OST394584 (lexicon) OST50999 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37527
Vector Insertion
Chr X: 71162812 - 71163267
Public Clones PST16212-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29517
Vector Insertion
Chr X: 71162228 - 71163267
Public Clones P119A09 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096316
Sequence
GAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCCGCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI17897 - CCCGAAGACCTGA

TGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAACTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCCCAG CTTTCTTACATTG

CTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGCTAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATATCACCTCACTG GCTGTG

AAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGATGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAAATACGTCTCCCTGCATG

TCAGGAAGAG TAACAGGGCCGCCCTGCATCTCTATTCCAACACCCTCAACTTTCA - UNI29517 - - UNI37527 - GATCAGCGAAGTGGAGC

CCAAATACTATGCAGATGGGGAAGATGCGTATGCAATGAAGCGGGACCTCACGCAGATGGCTGATGAGGTAAGAGTTCAGCCAGTCCAGGGCAGCAATTC

CAGCAGCAGGGGAGATTCTGTACTTGGGAAAGGTGGCTACTTTAGAGCTGTGAGACTGAGTGAGGCAGTGGTGGCTAGAGGCAAGACCAAGATTGAGTGT

CAGCCCTTGTCGTTGTAGAGCCCCTCTTTCCCTCACTTCCTAAGCTGTCAAGTTGTGACATGGCCTCTGTTGACTCTAGAGGGGGCTATGGGATGCTTTC

TAGGGAAGAAGCCTGGAGGTGGGTGGAACAGGAGAGAGAGTAGGAAGATATTTTTCTAGGGAGAGGGACTACTAGGGTCAGGGGCAGCCTGCTCAGATTT

AGGACTAAACTGGGCTAGGGGGAAAGGGTCTCTGACC
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKS SNRAALHLYSNTLNFQ - UNI29517 - - UNI37527 - QISEVEPKYYADGEDAYAMKRDLT

QMADEVRVQPVQGSNSSSRGDSVLGKGGYFRAVRLSEAVVARGKTKIECQPLSL
Transcript ENSMUST00000114387
Sequence
CCAGGATCCTGGCCCCAGTCCAAGCTCCTATCGTCCTTTCCCTGCTTCTAAGTGGCCGCCGAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCC

GCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI17897 - CCCGAAGACCTGATGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAA

CTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCCCAG CTTTCTTACATTGCTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGC

TAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATATCACCTCACTG GCTGTGAAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGA

TGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAAATACGTCTCCCTGCATGTCAGGAAGAG TAACAGGGCCGCCCTGCATCTCTATTCCA

ACACCCTCAACTTTCA - UNI29517 - - UNI37527 - GATCAGCGAAGTGGAGCCCAAATACTATGCAGATGGGGAAGATGCGTATGCAATGAA

GCGGGACCTCACGCAGATGGCTGATGAG - UNI29517 - - UNI37527 - CCTCAGGGCCTGGCTCCTCTTGTCTCCTGTCTGGAGACTTAGGCC

CTGTCTCTTTCCACCCGCTTCCCTCTGGGCTCCTGGCGGCAGCTGAGGCGGCACCTGGAGCTGAAGGAAAAGGGCAAGCACATGGTTCTGGCGGCCTTGG

AGAACAAAGCGGAGAACAAAGGCAACGTGCTTCTGAGCTCAGGAGAGGCCTGTCGTGAGGAGAAGGGCCTGGCTGCTGAGGATAGTGGTGGGGACAGCAA

GGACCTCAGTGAGGTCAGCGAGACCACAGAGAGCACAGATGTCAAAGACAGCTCAGAGGCCTCTGACTCTGCCTCCTAGAACCTGCCCCACCTGGTCCCA

ACCTTGCCCCATGTGCTTTTACAATAAATGTCACCCAGTGGCCTTGGGAAA
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKS SNRAALHLYSNTLNFQ - UNI29517 - - UNI37527 - QISEVEPKYYADGEDAYAMKRDLT

QMADE - UNI29517 - - UNI37527 - PQGLAPLVSCLET
Transcript ENSMUST00000114389
Sequence
GCTTCTAAGTGGCCGCCGAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCCGCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI1789

7 - CCCGAAGACCTGATGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAACTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCC

CAG CTTTCTTACATTGCTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGCTAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATAT

CACCTCACTG GCTGTGAAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGATGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAA

ATACGTCTCCCTGCATGTCAGGAAGAG TAACAGGGCCGCCCTGCATCTCTATTCCAACACCCTCAACTTTCA - UNI29517 - - UNI37527 - 

GATCAGCGAAGTGGAGCCCAAATACTATGCAGATGGGGAAGATGCGTATGCAATGAAGCGGGACCTCACGCAGATGGCTGATGAG - UNI29517 - -

 UNI37527 - CCAGCCTCAGGGCCTGGCTCCTCTTGTCTCCTGTCTGGAGACTTAGGCCCTGTCTCTTTCCACCCGCTTCCCTCTGGGCTCCTGGCGG

CAGCTGAGGCGGCACCTGGAGCTGAAGGAAAAGGGCAAGCACATGGTTCTGGCGGCCTTGGAGAACAAAGCGGAGAACAAAGGCAACGTGCTTCTGAGCT

CAGGAGAGGCCTGTCGTGAGGAGAAGGGCCTGGCTGCTGAGGATAGTGGTGGGGACAGCAAGGACCTCAGTGAGGTCAGCGAGACCACAGAGAGCACAGA

TGTCAAAGACAGCTCAGAGGCCTCTGACTCTGCCTCCTAGAACCTGCCCCACCTGGTCCCAACCTTGCCCCATGTGCTTTTACAATAAATGTCACCCAGT

GGCCTTGGG
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKS SNRAALHLYSNTLNFQ - UNI29517 - - UNI37527 - QISEVEPKYYADGEDAYAMKRDLT

QMADE - UNI29517 - - UNI37527 - PASGPGSSCLLSGDLGPVSFHPLPSGLLAAAEAAPGAEGKGQAHGSGGLGEQSGEQRQRASELRRGLS

Transcript ENSMUST00000114390
Sequence
CGCCGAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCCGCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI17897 - CCCGAAGAC

CTGATGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAACTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCCCAG CTTTCTTAC

ATTGCTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGCTAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATATCACCTCACTG GC

TGTGAAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGATGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAAATACGTCTCCCTG

CATGTCAGGAAGAG GGCCGCCCTGCATCTCTATTCCAACACCCTCAACTTTCA - UNI29517 - - UNI37527 - GATCAGCGAAGTGGAGCCC

AAATACTATGCAGATGGGGAAGATGCGTATGCAATGAAGCGGGACCTCACGCAGATGGCTGATGAG - UNI29517 - - UNI37527 - CTGAGGC

GGCACCTGGAGCTGAAGGAAAAGGGCAAGCACATGGTTCTGGCGGCCTTGGAGAACAAAGCGGAGAACAAAGGCAACGTGCTTCTGAGCTCAGGAGAGGC

CTGTCGTGAGGAGAAGGGCCTGGCTGCTGAGGATAGTGGTGGGGACAGCAAGGACCTCAGTGAGGTCAGCGAGACCACAGAGAGCACAGATGTCAAAGAC

AGCTCAGAGGCCTCTGACTCTGCCTCCTAGAACCTGCCCCACCTGGTCCCAACCTTGCCCCATGTGCTT
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKR RAALHLYSNTLNFQ - UNI29517 - - UNI37527 - QISEVEPKYYADGEDAYAMKRDLTQM

ADE - UNI29517 - - UNI37527 - LRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDS

SEASDSAS
Transcript ENSMUST00000114391
Sequence
GCTTCTAAGTGGCCGCCGAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCCGCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI1789

7 - CCCGAAGACCTGATGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAACTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCC

CAG CTTTCTTACATTGCTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGCTAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATAT

CACCTCACTG GCTGTGAAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGATGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAA

ATACGTCTCCCTGCATGTCAGGAAGAG - UNI29517 - - UNI37527 - GATCAGCGAAGTGGAGCCCAAATACTATGCAGATGGGGAAGATGCG

TATGCAATGAAGCGGGACCTCACGCAGATGGCTGATGAG - UNI29517 - - UNI37527 - CTGAGGCGGCACCTGGAGCTGAAGGAAAAGGGCA

AGCACATGGTTCTGGCGGCCTTGGAGAACAAAGCGGAGAACAAAGGCAACGTGCTTCTGAGCTCAGGAGAGGCCTGTCGTGAGGAGAAGGGCCTGGCTGC

TGAGGATAGTGGTGGGGACAGCAAGGACCTCAGTGAGGTCAGCGAGACCACAGAGAGCACAGATGTCAAAGACAGCTCAGAGGCCTCTGACTCTGCCTCC

TAG
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKR - UNI29517 - - UNI37527 - RISEVEPKYYADGEDAYAMKRDLTQMADE - UNI29517 

- - UNI37527 - LRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Transcript ENSMUST00000033763
Sequence
GCTTCTAAGTGGCCGCCGAGTGCACGCGTTCACGACCCACAAGGACCCGCGAGCTCCGCCGCCGCCGCGATGAACATCCGCAATGCTAGG - UNI1789

7 - CCCGAAGACCTGATGAACATGCAGCACTGCAACCTTCTCTGCCTGCCGGAGAACTACCAGATGAAGTACTATTTCTATCATGGCCTCTCTTGGCCC

CAG CTTTCTTACATTGCTGAGGATGAGAATGGGAAGATTGTGGGCTACGTCTTGGCTAAAAT GGAAGAGGACCCAGACGATGTGCCCCATGGACATAT

CACCTCACTG GCTGTGAAGCGTTCCCACCGGCGCCTTGGCCTGGCTCAGAAGCTGATGGACCAGGCCTCTCGAGCCATGATAGAGAACTTCAATGCCAA

ATACGTCTCCCTGCATGTCAGGAAGAG TAACAGGGCCGCCCTGCATCTCTATTCCAACACCCTCAACTTTCA - UNI29517 - - UNI37527 - 

GATCAGCGAAGTGGAGCCCAAATACTATGCAGATGGGGAAGATGCGTATGCAATGAAGCGGGACCTCACGCAGATGGCTGATGAG - UNI29517 - -

 UNI37527 - CTGAGGCGGCACCTGGAGCTGAAGGAAAAGGGCAAGCACATGGTTCTGGCGGCCTTGGAGAACAAAGCGGAGAACAAAGGCAACGTGC

TTCTGAGCTCAGGAGAGGCCTGTCGTGAGGAGAAGGGCCTGGCTGCTGAGGATAGTGGTGGGGACAGCAAGGACCTCAGTGAGGTCAGCGAGACCACAGA

GAGCACAGATGTCAAAGACAGCTCAGAGGCCTCTGACTCTGCCTCCTAG
Translation
MNIRNAR - UNI17897 - PEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQ LSYIAEDENGKIVGYVLAKM MEEDPDDVPHGHITSL AVKRSHR

RLGLAQKLMDQASRAMIENFNAKYVSLHVRKS SNRAALHLYSNTLNFQ - UNI29517 - - UNI37527 - QISEVEPKYYADGEDAYAMKRDLT

QMADE - UNI29517 - - UNI37527 - LRRHLELKEKGKHMVLAALENKAENKGNVLLSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVK

DSSEASDSAS

For any suggestions or comments, please send an email to unitrap@crg.es