Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031392 (Irak1)
Chromosomal location
Chr X: 71259257 - 71269254 (-)
Description
interleukin-1 receptor-associated kinase 1 Gene [Source:MGI (curated);Acc:Irak1-004]
RefSeq_dna
NM_008363 
RefSeq_peptide
NP_032389.2 
UniGene
Mm.38241 
MGI
MGI:107420 
Uniprot/SWISSPROT
Q62406 
Uniprot/SPTREMBL
B1AUW2 B1AUW0 B1AUV9 B1AUV8 Q8K4N7 B1AUW9 Q8K4N6 Q540G0 Q8K4N8 B1AUW8 Q8BR10 B1AUW6 Q99J34 B1AUW4 
Human Ortholog
ENSG00000184216 (IRAK1)
Omim not available
UniTrap UNI27781
Vector Insertion
Chr X: 71265666 - 71265875
Public Clones not available
Private Clones OST49424 (lexicon)
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24410
Vector Insertion
Chr X: 71265238 - 71265305
Public Clones not available
Private Clones OST221817 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35001
Vector Insertion
Chr X: 71263468 - 71265305
Public Clones IST14733C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114334
Sequence
AGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCC

CCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGC

CGACTGGTGCCAGTTCGGTGGGTGACGGCAGGCCGGCGTGGGGTGGTGGACTCAGGCTTCTGGAGCTGAAGCCTGATGTTCCCCATCCCGCAGCGGCCTT

GATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCT

GACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCT

GCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTT

CCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG 

CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCT

CTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAGGAG ACCCAGG

CCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGG

AGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTG

CGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACT

GGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCA

GAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCT

GGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGG

ACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGAC

CCAG - UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGG

AGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCA

ACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCA

AGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG

 GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATG

AAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATG

AATTCCAGAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGC

CCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAAC

TTGATAGAAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGG

CTGGTGAGATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAAC

AAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTA

CACAGGCCCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGA

ACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
 SASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK QSSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMR

NTTYAVKRLKE TQACSPLSWPQRLDILLGTAR - UNI27781 -  - UNI24410 - - UNI27781 - - UNI35001 -  - UNI24410 -

 - UNI35001 -  - UNI35001 -   
Transcript ENSMUST00000114339
Sequence
AGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCC

CCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGC

CGACTGGTGCCAGTTCGGTGGGTGACGGCAGGCCGGCGTGGGGTGGTGGACTCAGGCTTCTGGAGCTGAAGCCTGATGTTCCCCATCCCGCAGCGGCCTT

GATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCT

GACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCT

GCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTT

CCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG 

CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCT

CTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTG

ACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTG

CAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGATCAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCT

GGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI

27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCC

AGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATAC

CTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCT

GAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCT

GGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI3

5001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTAC

ATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAA

GTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTC

CTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCACCCAC

GGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTC

TTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGC

TGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATC

AGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGC

TGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATG

GCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACG

CCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAG

AGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAA

ACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
   MRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTA

RAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTF

SFGV - UNI24410 - - UNI27781 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLG

LALAQLACCCMHRRAKKRPPMTQ - UNI35001 - VYKRLEGLQA  
Transcript ENSMUST00000114344
Sequence
AGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCC

CCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGC

CGACTGGTGCCAGTTCGGTGGGTGACGGCAGGCCGGCGTGGGGTGGTGGACTCAGGCTTCTGGAGCTGAAGCCTGATGTTCCCCATCCCGCAGCGGCCTT

GATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCT

GACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCT

GCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTT

CCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG 

CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCT

CTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTG

ACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGA

CATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACG

TGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGC

CCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG

 - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAG

TATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGT

GGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGG

CCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GCTCACCCACGGGCAG

CTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGAT

AGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTT

GTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGT

GGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAA

GGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAG

TGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCT

TCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACA

CAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCA

AGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
      - UNI27781 - MPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27

781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWA

APIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQ - UNI35001 - AHPRAAHPCCHQNHHRSSSTQPDRRWYKSWLFMKKGSWI

ACNCCHQAFSQ AWI
Transcript ENSMUST00000114347
Sequence
AGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCC

CCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGC

CGACTGGTGCCAGTTCGGTGGGTGACGGCAGGCCGGCGTGGGGTGGTGGACTCAGGCTTCTGGAGCTGAAGCCTGATGTTCCCCATCCCGCAGCGGCCTT

GATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCT

GACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCT

GCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTT

CCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG 

CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCT

CTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTG

ACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGA

CATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACG

TGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGC

CCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG

 - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAG

TATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGT

GGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGG

CCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GTATACAAGAGACTAG

AAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCA

GAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGT

GATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCC

AGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGAC

CTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGC

AAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAG

GGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAA

AACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTC

ACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACA

GAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTG

AGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
      - UNI27781 - MPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27

781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWA

APIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQ

SGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GLDLEPEKSQ

GPEESDEFQS
Transcript ENSMUST00000114714
Sequence
AGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCC

CCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGC

CGACTGGTGCCAGTTCGGTGGGTGACGGCAGGCCGGCGTGGGGTGGTGGACTCAGGCTTCTGGAGCTGAAGCCTGATGTTCCCCATCCCGCAGCGGCCTT

GATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCT

GACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCT

GCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTT

CCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG 

CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCT

CTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTG

ACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGA

CATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACG

TGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGC

CCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG

 - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAG

TATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGT

GGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGG

CCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GTATACAAGAGACTAG

AAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCA

GAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGT

GATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCC

AGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCAT

CAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTC

ATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGACAAATC

CCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCA

AAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATGTGAGGC

CAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGCACCCGA

TTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGA

CAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCTGTTTGT

ATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTG

TGCTTGTAAATTGC
Translation
      - UNI27781 - MPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27

781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWA

APIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQ

SGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLL

SSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000073369
Sequence
ATGGACGCCCTGGAGCCCGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACA

GCCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCA

CAGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCC

GGAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTT

CCCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTT

GCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAG

AAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG

 GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGA

TCAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCA

GGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTG

GCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGA

GGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GT

AATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTG

ATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTG

CCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCG

GGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCG

GCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAG

AGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGG

CACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAG

GCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGA

TGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGA

GCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTC

ATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAA

CACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGG

GTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACA

TGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAA

AAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTG

CAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
MDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAW WHPPAPVVPPSTAAPRPSSISAGSEAGD

WSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRAHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCV

YRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGFLPNGSLEDQLHLQ TQACSPLSWPQRLDILLGT

ARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDT

FSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL - UNI24410 - - UNI35001 - KDLIED

EAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKKRPPMTQ - UNI35001 - VYKRLEGLQAGPP

WELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRES

SVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000101458
Sequence
ATGGCCGGGGGGCCGGGCCCCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGA

TGGACGCCCTGGAGCCCGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAG

CCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCAC

AGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCG

GAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTC

CCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTG

CTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGA

AATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG 

GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGAT

CAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAG

GATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGG

CCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAG

GAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTA

ATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTGA

TTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGC

CCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGG

GCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GAGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCC

TCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCT

GCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAA

GTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCA

ACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGG

ATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGA
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRA

HPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGF

LPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQ

SSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL

 - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKK

RPPMTQ - UNI35001 - ENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQG

GTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000068286
Sequence
CCGCGGAGGGCAAGATGGCGGCGGGTCGAGCGCCGCCTCTTCCGCCCGGCCGGGTGTCGCACGAGGCCGGCCTGAAGGGGAAGTGAGTCAGTGTCCGCGG

ACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCCCCGGGGAGCCT

GTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGCCGACTGGTGCC

AGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCA

ACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGC

CCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCT

CTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCC

TTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCAC

CTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAG

GAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG GTTTCGTCACCCAAATATCGTAGACTTTGC

TGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGATCAGCTCCACCTTCAG ACCCAGGCCTGCTC

CCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATC

AAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGC

CAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTG

GACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCAGAGGGCT

GTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGA

CCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAG

ACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - 

UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTC

CTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAG

AGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAG

CGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCAC

CCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGG

GGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCA

GAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAG ATTTCGTGGATATTGATGCTATTGGAATTGAAGCCTTCATGTCTGAATTATTCATCAA

TCATATATAGAAATTTCATTAAGTTTTGATCCTGATCTTTATTCTGTGGCCTTACTTCTTAGCCCCACTTGTTTTGGGGGTGATTACTCTGAGATAGTTT

GTATACAATCAACCTATCTGAAAATAAAGATAATTTTACTCC
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRA

HPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGF

LPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQ

SSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL

 - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKK

RPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLS

ATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG

 GLDLEPEKSQGPEESDEFQS 
Transcript ENSMUST00000114352
Sequence
CCGCGGAGGGCAAGATGGCGGCGGGTCGAGCGCCGCCTCTTCCGCCCGGCCGGGTGTCGCACGAGGCCGGCCTGAAGGGGAAGTGAGTCAGTGTCCGCGG

ACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGGGCCCCGGGGAGCCT

GTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCCCGCCGACTGGTGCC

AGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCCCTGGATCAACCGCA

ACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCCTGCCCCCGTTGTGC

CCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCTGCCTCCACCTTCCT

CTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTACCATCTTCAGCCCC

TTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAGATTTCCCAAGGCAC

CTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTGTGAAGAGACTGAAG

GAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG GTTTCGTCACCCAAATATCGTAGACTTTGC

TGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGATCAGCTCCACCTTCAG ACCCAGGCCTGCTC

CCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTATCCATGGAGACATC

AAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGC

CAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAGGCCGACTGGCTGTG

GACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTGCTGGTCAGAGGGCT

GTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGAAGAGGCTGGAGTGA

CCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAGCACCTGGACTCCAG

ACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCCCCATGACCCAG - 

UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTC

CTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAG

AGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAG

CGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCAC

CCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGG

GGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCA

GAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGG

CATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAG

AAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGA

GATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCT

GACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGC

CCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCC

TAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGCAAAAAAAAAAAAAAAAAAAAAAAAAAGAGTGTCTTACAGTTCAGTCCACTAGCTAGAAG

TGAGCACTCTGAGATTCTCCCAAGAGTCTAATAAAACCCCCCTCCCCATCTTGGGTGGATATATGCAAGCCTTGCCAGATAGCAGTGAGCTAGTTTCATA

TGACTACCTGCCTGCCTAGGCAGGCTCTCTCTATACCCTGCAAATTGACTGTGGATGCCCAAGGTTCTGCTTATGGCAGAAAGGTCCAGCAAAGCCCAGC

TTTGTGGTACCCAGACAGTGAGAAGCCCCAAGAAAGAAGAAACTGAGAGCAAAGCTAAGTATTTGAGGGGGAAGAATGTTACATTTAAAAAAAAAACAAC

AAGTTTTTGTATAATTAAGTGTCTTCACAAGTAGCCCAGGGCTATAGCCCAGGCTTACAGTGATTCTGTGTTTGAGTCATGAGTCACACTACATGCCCCT

GTGTAATTGGTGACATCCAATTTGTCCTTGAGTAATAAAAGCATACATTTCACTGTCTGGTTAAACTTGTGGAATTTGTTGTGCTAAAAGTGTTATGCTT

TCCTAATGCTTTATATCTCTGGGCTCTTAAGTGTCCACCCAAAACTCAGGCCCCTAGCATTTGTTCTTTTCTCTTGTCAGGCCAGACTGGGGATAGATCC

CCTTGCTTTCTTGTCTTGCAGATTTCGTGGATATTGATGCTATTGGAATTGAAGCCTTCATGTCTGAATTATTCATCAATCATATATAGAAATTTCATTA

AGTTTTGATCCTGATCTTTATTCTGTGGCCTTACTTCTTAGCCCCACTTGTTTTGGGGGTGATTACTCTGAGATAGTTTGTATACAATCAACCTATCTGA

AAATAAAGATAATTTTACTCCATTGCCAA
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRA

HPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGF

LPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQ

SSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL

 - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKK

RPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLS

ATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG

 GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000114353
Sequence
ATGGCCGGGGGGCCGGGCCCCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGA

TGGACGCCCTGGAGCCCGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAG

CCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCAC

AGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCG

GAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTC

CCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTG

CTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGA

AATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG 

GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGAT

CAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAG

GATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGG

CCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAG

GAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTA

ATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - GTATACAAGA

GACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAG

TGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTG

GAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCT

GTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGC

TGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACT

GCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGA

CAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACT

CTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATG

TGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGC

ACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTC

TGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCT

GTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAG

CTGTTGTGCTTGTAAATTGC
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRA

HPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGF

LPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQ

SSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL

 - UNI24410 - - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESD

ESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLL

SSGFFPG GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000114354
Sequence
ATGGCCGGGGGGCCGGGCCCCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGA

TGGACGCCCTGGAGCCCGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAG

CCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCAC

AGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCG

GAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTC

CCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTT

TTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATG

AGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCA

AG GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAG

GATCAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACAT

CAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTT

TGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCT

GAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - 

GTAATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACC

TGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGC

TGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGT

CGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGC

CGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACA

AGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCT

GGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCC

AGGCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAA

GATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTTGGATTTAGAACCTGAAAA

GAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGTTCTCATGCTTGGAAGTTC

TCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCCTGCTGTTCTCAGAATGTG

AACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAGCAGAGTACCTAAGGAATT

GGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAGTTCAAATCCCAGCAACCA

CATGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATATAATAAATAAATCTTTAAA

AAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTGAGAGCTAGATAATATATC

TGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK QSSPESPVSGLQR

AHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYG

FLPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKAS

QSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKY

L - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAK

KRPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGL

SATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFP

G GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000033769
Sequence
ATGGCCGGGGGGCCGGGCCCCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGA

TGGACGCCCTGGAGCCCGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAG

CCAGTGTTCTGTGGCCCTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCAC

AGCCT GGCACCCTCCTGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCG

GAAATTGCAGTCCTCTGCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTC

CCTCGGGCCACCACTACCATCTTCAGCCCCTTCCTCCACCAAG CAGTCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTT

TTGCTGGCCCTTCTGTGAGATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATG

AGAAATACTACATATGCTGTGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCA

AG GTTTCGTCACCCAAATATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAG

GATCAGCTCCACCTTCAG ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACAT

CAGGATAGCCCCAGCCTTATCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTT

TGGCCTGGCTCGTTTCAGCCGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCT

GAGGAGTACATCAAGACAGGCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - 

GTAATACTGGAGACCCTTGCTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACC

TGATTGAAGATGAGGCTGAAGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGC

TGCCCAGATCTATAAGAAGCACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGT

CGGGCCAAGAAGAGGCCCCCCATGACCCAG - UNI35001 - AGGCAAAACTCCCAACATTCCTTGCTTGCCCTTTGGCTCTATTTGGGGAGGTGCTC

TGTGGAACTAAGTGGTAAAGGGCTGCTGCTTTGCTGGATGAGCCTCAGATCCCAGGAACAG GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCC

CTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCCCCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAG

CCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTGCCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCT

CTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTCCCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATC

AAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACCATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCAT

CAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCTCTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG GCTT

GGATTTAGAACCTGAAAAGAGCCAGGGACCTGAAGAAAGTGATGAATTCCAGAGCTGATTTGTTCACTCTGACAAATCCCTCAGACTCAGAGGTCAAAGT

TCTCATGCTTGGAAGTTCTCATAGTGTGCAAACTCCTCAGTAGCCCAAAGGCATCAGGTGTGGGGGCTCACTCTGGCAAAGGAGAGAGGGCAGTGGACCC

TGCTGTTCTCAGAATGTGAACACAGACAGGGCCAGCCAAAGAACTTGATAGAAGCTGATAAGGCAGGCAATGTGAGGCCAGCATTTGTGAGCAAGGCAAG

CAGAGTACCTAAGGAATTGGGTAGTACAAAACAGAAGACTGGGGCTGGTGAGATGGCTCAGTGGGTATGAGCACCCGATTGCTCTTCCAAAGGTCCGGAG

TTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAACAAGATCTGACGCCCTCTTCTGGAGTGTCTGAAGACAGCTACAGTGTACTTATATAT

AATAAATAAATCTTTAAAAAAAAAAAACAGAAGACTGCTAGCTACACAGGCCCAGAGGACACAAGTAGGTCTGTTTGTATGGTGGGAGCTAGCTCCCCTG

AGAGCTAGATAATATATCTGCAGTCTGTGAGTCTATTCCTCAGAACTTCCCTAAAACACCAAGCGAAAGTAGCTGTTGTGCTTGTAAATTGC
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK QSSPESPVSGLQR

AHPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYG

FLPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKAS

QSSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKY

L - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAK

KRPPMTQ - UNI35001 - RQNSQHSLLALWLYLGRCSVELSGKGLLLCWMSLRSQEQ VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQ

SGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLSATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLL

SSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPG GLDLEPEKSQGPEESDEFQS
Transcript ENSMUST00000114360
Sequence
GTCAGTGTCCGCGGACCCGGCCCGCTAAGGCCCGCGCCCGCCGAGGCCCCGAGAGGCCTCGGCCCGGGGGCGGCGGCGGCGGCCATGGCCGGGGGGCCGG

GCCCCGGGGAGCCTGTGGTTCCAGGCGCCCAGCACTTCTTGTACGAGGTGCCACCCTGGGTTATGTGCCGCTTCTACAAAGTGATGGACGCCCTGGAGCC

CGCCGACTGGTGCCAGTTCG CGGCCTTGATCGTGCGCGACCAGACAGAGCTGCGGCTGTGCGAGCGCTCCGAGCAGCGCACAGCCAGTGTTCTGTGGCC

CTGGATCAACCGCAACGCGCGCGTAGCTGACCTCGTTCACATCCTCACGCACCTGCAGCTGCTGCGTGCGAGGGACATCATCACAGCCT GGCACCCTCC

TGCCCCCGTTGTGCCCCCAAGCACCGCTGCCCCAAGGCCCAGCAGCATCTCTGCAGGCTCTGAGGCCGGGGACTGGAGCCCCCGGAAATTGCAGTCCTCT

GCCTCCACCTTCCTCTCCCCAG CTTTTCCAGGCTCCCAGACCCATTCTGAGTCAGAGCTCCTCCAGGTTCCACTCCCTGTTTCCCTCGGGCCACCACTA

CCATCTTCAGCCCCTTCCTCCACCAAG TCAAGCCCAGAGAGCCCAGTGTCTGGCCTCCAAAGAGCCCATCCCTCCCCGTTTTGCTGGCCCTTCTGTGAG

ATTTCCCAAGGCACCTGCAACTTCTCTGAAGAACTCAGGATTGGAGAGGGTGGTTTTGGATGTGTGTACCGAGCAGTCATGAGAAATACTACATATGCTG

TGAAGAGACTGAAGGAG GAAGCTGACCTAGAGTGGACTATGGTGAAACAGAGCTTCTTAACAGAGGTGGAACAGCTATCAAG GTTTCGTCACCCAAAT

ATCGTAGACTTTGCTGGCTACTGTGCAGAGAGTGGCTTATACTGCCTTGTTTATGGCTTCTTGCCCAATGGCTCCTTGGAGGATCAGCTCCACCTTCAG 

ACCCAGGCCTGCTCCCCACTTTCCTGGCCTCAACGACTGGACATTCTTCTGGGCACAGCCCGGGCTATTCAGTTTTTACATCAGGATAGCCCCAGCCTTA

TCCATGGAGACATCAAGAG - UNI27781 - TTCTAACGTGCTTCTGGATGAGAGACTGATGCCCAAGCTGGGAGACTTTGGCCTGGCTCGTTTCAGC

CGCTTTGCGGGGGCCAAAGCAAGCCAGAGCAGTACTGTGGCCCGGACTTCCACAGTTCGAGGTACCCTCGCCTACTTGCCTGAGGAGTACATCAAGACAG

GCCGACTGGCTGTGGACACCGATACCTTCAGCTTTGGGGTG - UNI24410 - - UNI27781 - - UNI35001 - GTAATACTGGAGACCCTTG

CTGGTCAGAGGGCTGTGAGGACACAAGGTGCAAAGACCAAGTATTTG - UNI24410 - - UNI35001 - AAAGACCTGATTGAAGATGAGGCTGA

AGAGGCTGGAGTGACCCTGAAAAGCACCCAGCCTACTCTGTGGGTGGGTGTAGCCACGGATGCTTGGGCTGCTCCAATTGCTGCCCAGATCTATAAGAAG

CACCTGGACTCCAGACCTGGGCCCTGCCCACCCCAGTTGGGCCTGGCCCTGGCTCAACTAGCTTGCTGCTGCATGCACCGTCGGGCCAAGAAGAGGCCCC

CCATGACCCAG - UNI35001 - GTATACAAGAGACTAGAAGGGCTTCAGGCAGGGCCTCCCTGGGAGCTAGAGGTTGCCGGCCATGGCTCCCCTTCC

CCACAGGAGAACTCCTACATGTCTACCACTGGCAGTGCCCAGAGTGGGGATGAACCATGGCAGCCTCTAGTAGTGACCACAAGAGCCCCAGCCCAGGCTG

CCCAGCAACTCCAGAGAAGTCCCAACCAGCCAGTGGAAAGTGATGAGAGTGTTCCCGGCCTCTCTGCTACCCTGCATTCCTGGCACTTGACTCCAGGTTC

CCACCCAAGCCCAGCGTCCTTCAGAGAGGCTAGCTGTACCCAGGGAGGCACTACCAGAGAATCAAGTGTGAGGAGTAGCCCAGGCTTCCAGCCTACAACC

ATGGAAG GCTCACCCACGGGCAGCTCATCCCTGCTGTCATCAGAACCACCACAGATCATCATCAACCCAGCCCGACAGAAGATGGTACAAAAGCTGGCT

CTTTATGAAGAAGGGGTCTTGGATAGCCTGCAACTGCTGTCATCAGGCTTTTTCCCAG ATTTCGTGGATATTGATGCTATTGGAATTGAAGCCTTCATG

TCTGAATTATTCATCAATCATATATAG
Translation
MAGGPGPGEPVVPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFA AALIVRDQTELRLCERSEQRTASVLWPWINRNARVADLVHILTHLQLLRARDI

ITAW WHPPAPVVPPSTAAPRPSSISAGSEAGDWSPRKLQSSASTFLSPA AFPGSQTHSESELLQVPLPVSLGPPLPSSAPSSTK SSPESPVSGLQRA

HPSPFCWPFCEISQGTCNFSEELRIGEGGFGCVYRAVMRNTTYAVKRLKE EADLEWTMVKQSFLTEVEQLSR RFRHPNIVDFAGYCAESGLYCLVYGF

LPNGSLEDQLHLQ TQACSPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKS - UNI27781 - SSNVLLDERLMPKLGDFGLARFSRFAGAKASQ

SSTVARTSTVRGTLAYLPEEYIKTGRLAVDTDTFSFGV - UNI24410 - - UNI27781 - - UNI35001 - VILETLAGQRAVRTQGAKTKYL

 - UNI24410 - - UNI35001 - KDLIEDEAEEAGVTLKSTQPTLWVGVATDAWAAPIAAQIYKKHLDSRPGPCPPQLGLALAQLACCCMHRRAKK

RPPMTQ - UNI35001 - VYKRLEGLQAGPPWELEVAGHGSPSPQENSYMSTTGSAQSGDEPWQPLVVTTRAPAQAAQQLQRSPNQPVESDESVPGLS

ATLHSWHLTPGSHPSPASFREASCTQGGTTRESSVRSSPGFQPTTMEG GSPTGSSSLLSSEPPQIIINPARQKMVQKLALYEEGVLDSLQLLSSGFFPD

 DFVDIDAIGIEAFMSELFINHI

For any suggestions or comments, please send an email to unitrap@crg.es