Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031402 (Mpp1)
Chromosomal location
Chr X: 72355072 - 72376288 (-)
Description
membrane protein, palmitoylated Gene [Source:MGI (curated);Acc:Mpp1-001]
RefSeq_dna
NM_008621 
RefSeq_peptide
NP_032647.1 
MGI
MGI:105941 
Uniprot/SWISSPROT
P70290 
Uniprot/SPTREMBL
A2AN84 Q542P4 Q684Q6 Q3THA8 
Human Ortholog
ENSG00000130830 (MPP1)
Omim not available
UniTrap UNI18407
Vector Insertion
Chr X: 72357741 - 72358924
Public Clones not available
Private Clones OST423946 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114091
Sequence
GATCCCTGCCTCCTCCGCCGCCTTAGTCTAGCTCGTCTCTGAACAGGCCGCAGTTCCCCGATTTGCGATTCCTGGGCTCAAAGCTCTGCGGCTACTGCGT

CTGGTTGTCTCTGCTCCTGAGAGATGACGCTCAAGTCGAGCGAAGGCGAGGGAGGGAACAGCATGCGCACCGCACTTTCGGACCTCTACCTGGAGCACTT

ACTACAGAAGCGTAACCGACCTGAG ACTTCATTGAACCAGTCAAATGTTACTACTGAGGACATGTACACCAATGGGTCCCCTGCTCCAGGTAGCCCTGC

CCATGCCAAAGGTCAGGAGGCTCGGAGAGTTCGTCTCATACAATTTGAGAAGATCACAGAAGAGCCCATG GGGATCACTTTGAAGCTGAATGAAAAACA

GTCGTGTACCGTGGCCAGAATTCTCCATGGCGGCATGATTCATAGACAAG GCTCCCTTCATGTTGGGGATGAGATCCTAGAAATCAATGGCACAAATGT

GACTAATCACTCAGTAGATCAGTTGCAGAAGGCAATG AAGGAAACCAAAGGAATGATCTCATTAAAAGTCATTGCTAATCAGCAGAGTCGCCTTCCTGC

GCTACAG ATGTTCATGAGAGCACAGTTTGACTATGATCCCCAAAAGGACAACCTTATTCCTTGCAAGGAGGCAGGACTGAAGTTTGTTACTGGAGACAT

TATCCAGATAATCAACAAAGATGACAGCAATTGGTGGCAGGGGCGGGTGGAGGGCTCCTCCAAAGAGTCTGCAGGATTAATCCCTTCTCCTGAGCTACAG

GAATG GAGAGTGGCAAGCGTGGCTCACTCTGCTCCAAGTGAAGCACCAAGTTGCAGTCCCTTTGGGAAGAAGAAGAAGTGTAAAGACAAGTACCTGGCT

AAGCACAGTTCCA TTTTTGACCAGTTGGATGTTGTTTCCTATGAGGAAGTTGTTCGGCTCCCTGCATTCAAGAGGAAGACCTTGGTGTTGATCG GAGC

CAGTGGGGTGGGTCGTAGCCATATTAAGAATGGTCTGCTCAGTCACAATCCAGAGAAGTTTGCGTACCCTGCCCCAT - UNI18407 - ATACAACAC

GGCCACCAAAGAAGAGTGAGGAAGATGGGAAGGAGTATCATTTCATCTCAACAGAGGAGATGACGAAGAACATCTCTGCCAATGAGTTCTTGGAGTTTGG

CAGCTATCAGGGCAACATGTTTGGCACCAAATTTGAAACAGTGCACCAGATTCATAAGCAGGACAAGATTGCCATCCTTGACATTGAGCCCCAG ACCCT

AAAGACTGTTCGGACAGCTGAGCTTTCACCTTTCATTGTGTTCATCGCACCTACTGACCAGGGCACTCAGGTGGGAAAGGGGTCACATGGGTGGAGGTCC

ACACCTTTTAGGTCATTGTCAACTGTTTTTTCCAAGGCCAAGAAGACAAAGGGCATGCATATTTTATTCATTCCAGAGTTATTCAAGAGATTAGTTATTA

AATAATTCAATTCTAGTCATAGTCCTGAATGAACAGTTCTAATGGCTGAGACGGACAGTTAAATAAATCCTATTTCTTATA
Translation
MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPE TSLNQSNVTTEDMYTNGSPAPGSPAHAKGQEARRVRLIQFEKITEEPM GITLKLNEKQSCTVAR

ILHGGMIHRQG GSLHVGDEILEINGTNVTNHSVDQLQKAM KETKGMISLKVIANQQSRLPALQ MFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQI

INKDDSNWWQGRVEGSSKESAGLIPSPELQEW WRVASVAHSAPSEAPSCSPFGKKKKCKDKYLAKHSSI IFDQLDVVSYEEVVRLPAFKRKTLVLIG 

GASGVGRSHIKNGLLSHNPEKFAYPAPY - UNI18407 - YTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQD

KIAILDIEPQ TLKTVRTAELSPFIVFIAPTDQGTQVGKGSHGWRSTPFRSLSTVFSKAKKTKGMHILFIPELFKRLVIK
Transcript ENSMUST00000114092
Sequence
TGTCTCTGCTCCTGAGAGATGACGCTCAAGTCGAGCGAAGGCGAGGGAGGGAACAGCATGCGCACCGCACTTTCGGACCTCTACCTGGAGCACTTACTAC

AGAAGCGTAACCGACCTGAG ACTTCATTGAACCAGTCAAATGTTACTACTGAGGACATGTACACCAATGGGTCCCCTGCTCCAGGTAGCCCTGCCCATG

CCAAAGGTCAGGAGGCTCGGAGAGTTCGTCTCATACAATTTGAGAAGATCACAGAAGAGCCCATG GGGATCACTTTGAAGCTGAATGAAAAACAGTCGT

GTACCGTGGCCAGAATTCTCCATGGCGGCATGATTCATAGACAAG GCTCCCTTCATGTTGGGGATGAGATCCTAGAAATCAATGGCACAAATGTGACTA

ATCACTCAGTAGATCAGTTGCAGAAGGCAATG AAGGAAACCAAAGGAATGATCTCATTAAAAGTCATTGCTAATCAGCAGAGTCGCCTTCCTGCGCTAC

AG GAGGCAGGACTGAAGTTTGTTACTGGAGACATTATCCAGATAATCAACAAAGATGACAGCAATTGGTGGCAGGGGCGGGTGGAGGGCTCCTCCAAAG

AGTCTGCAGGATTAATCCCTTCTCCTGAGCTACAGGAATG GAGAGTGGCAAGCGTGGCTCACTCTGCTCCAAGTGAAGCACCAAGTTGCAGTCCCTTTG

GGAAGAAGAAGAAGTGTAAAGACAAGTACCTGGCTAAGCACAGTTCCA TTTTTGACCAGTTGGATGTTGTTTCCTATGAGGAAGTTGTTCGGCTCCCTG

CATTCAAGAGGAAGACCTTGGTGTTGATCG GAGCCAGTGGGGTGGGTCGTAGCCATATTAAGAATGGTCTGCTCAGTCACAATCCAGAGAAGTTTGCGT

ACCCTGCCCCAT - UNI18407 - ATACAACACGGCCACCAAAGAAGAGTGAGGAAGATGGGAAGGAGTATCATTTCATCTCAACAGAGGAGATGACG

AAGAACATCTCTGCCAATGAGTTCTTGGAGTTTGGCAGCTATCAGGGCAACATGTTTGGCACCAAATTTGAAACAGTGCACCAGATTCATAAGCAGGACA

AGATTGCCATCCTTGACATTGAGCCCCAG ACCCTAAAGACTGTTCGGACAGCTGAGCTTTCACCTTTCATTGTGTTCATCGCACCTACTGACCAGGGCA

CTCAG ACTGAAGCCCTGCAGCAGCTGCAGAAGGACTCTGAGGCCATCCGTAGTCAGTATGCTCATTACTTTGACCTCTCTTTGGTGAATAATAGTGTTG

ATGAAACTCTTAAGAAATTGCAAGAAGCCTTTGACCAGGCTTGCAGTTCTCCACAGTGGGTGCCTGTCTCCTGGGTTTACTAAGCTTACAGAATTGGCAA

AC
Translation
MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPE TSLNQSNVTTEDMYTNGSPAPGSPAHAKGQEARRVRLIQFEKITEEPM GITLKLNEKQSCTVAR

ILHGGMIHRQG GSLHVGDEILEINGTNVTNHSVDQLQKAM KETKGMISLKVIANQQSRLPALQ EAGLKFVTGDIIQIINKDDSNWWQGRVEGSSKES

AGLIPSPELQEW WRVASVAHSAPSEAPSCSPFGKKKKCKDKYLAKHSSI IFDQLDVVSYEEVVRLPAFKRKTLVLIG GASGVGRSHIKNGLLSHNPE

KFAYPAPY - UNI18407 - YTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQ TLKTVRTAE

LSPFIVFIAPTDQGTQ TEALQQLQKDSEAIRSQYAHYFDLSLVNNSVDETLKKLQEAFDQACSSPQWVPVSWVY
Transcript ENSMUST00000033775
Sequence
GATCCCTGCCTCCTCCGCCGCCTTAGTCTAGCTCGTCTCTGAACAGGCCGCAGTTCCCCGATTTGCGATTCCTGGGCTCAAAGCTCTGCGGCTACTGCGT

CTGGTTGTCTCTGCTCCTGAGAGATGACGCTCAAGTCGAGCGAAGGCGAGGGAGGGAACAGCATGCGCACCGCACTTTCGGACCTCTACCTGGAGCACTT

ACTACAGAAGCGTAACCGACCTGAG ACTTCATTGAACCAGTCAAATGTTACTACTGAGGACATGTACACCAATGGGTCCCCTGCTCCAGGTAGCCCTGC

CCATGCCAAAGGTCAGGAGGCTCGGAGAGTTCGTCTCATACAATTTGAGAAGATCACAGAAGAGCCCATG GGGATCACTTTGAAGCTGAATGAAAAACA

GTCGTGTACCGTGGCCAGAATTCTCCATGGCGGCATGATTCATAGACAAG GCTCCCTTCATGTTGGGGATGAGATCCTAGAAATCAATGGCACAAATGT

GACTAATCACTCAGTAGATCAGTTGCAGAAGGCAATG AAGGAAACCAAAGGAATGATCTCATTAAAAGTCATTGCTAATCAGCAGAGTCGCCTTCCTGC

GCTACAG ATGTTCATGAGAGCACAGTTTGACTATGATCCCCAAAAGGACAACCTTATTCCTTGCAAGGAGGCAGGACTGAAGTTTGTTACTGGAGACAT

TATCCAGATAATCAACAAAGATGACAGCAATTGGTGGCAGGGGCGGGTGGAGGGCTCCTCCAAAGAGTCTGCAGGATTAATCCCTTCTCCTGAGCTACAG

GAATG GAGAGTGGCAAGCGTGGCTCACTCTGCTCCAAGTGAAGCACCAAGTTGCAGTCCCTTTGGGAAGAAGAAGAAGTGTAAAGACAAGTACCTGGCT

AAGCACAGTTCCA TTTTTGACCAGTTGGATGTTGTTTCCTATGAGGAAGTTGTTCGGCTCCCTGCATTCAAGAGGAAGACCTTGGTGTTGATCG GAGC

CAGTGGGGTGGGTCGTAGCCATATTAAGAATGGTCTGCTCAGTCACAATCCAGAGAAGTTTGCGTACCCTGCCCCAT - UNI18407 - ATACAACAC

GGCCACCAAAGAAGAGTGAGGAAGATGGGAAGGAGTATCATTTCATCTCAACAGAGGAGATGACGAAGAACATCTCTGCCAATGAGTTCTTGGAGTTTGG

CAGCTATCAGGGCAACATGTTTGGCACCAAATTTGAAACAGTGCACCAGATTCATAAGCAGGACAAGATTGCCATCCTTGACATTGAGCCCCAG ACCCT

AAAGACTGTTCGGACAGCTGAGCTTTCACCTTTCATTGTGTTCATCGCACCTACTGACCAGGGCACTCAG ACTGAAGCCCTGCAGCAGCTGCAGAAGGA

CTCTGAGGCCATCCGTAGTCAGTATGCTCATTACTTTGACCTCTCTTTGGTGAATAATAGTGTTGATGAAACTCTTAAGAAATTGCAAGAAGCCTTTGAC

CAGGCTTGCAGTTCTCCACAGTGGGTGCCTGTCTCCTGGGTTTACTAAGCTTACAGAATTGGCAAACATGTTTCAGCCAGCATTTGGAATGCCACCTCCC

CGCACCCCCTCCCTTGCTTAAGCCAAAAGGGTTGCTTCAACTTTTAGCTCTGCTGTTTTCTTACTCAGGCTCCTAAAGGGGTGAAGCTTTCCTACTATCT

ACATTTCAAAATGATCTCTGGAAAATTGCCATAAGAATAACCAAATGCAATGCTACATAGATAAACCAACTGTCCCCCTGAAGCCTGAGCTCCTTTGCTT

TCAACTATAGAATGTCTTTTTACTCTGGAATAAATATCTTCTGAAAACTTTCTAAAATGCCAAAATCAAACAGCTGTGCAATAGAATGTCTGCTGTAGGG

AAAATCTTCCAAAGCAATAAAAATGCTGCTGTGTTAAAGTACCCGTGACCCTGTAACTCCATTCCCAATCTTAACCTTCCAAGCAATGACATTAACATAA

GATCTCTGGGAATTACCTGTCACTGCCTCTATAGGTCTGGTATTCACAATGCACAAAGGCGTCTTCTCTAGGACTTGTTAAGTCGTAAGAGAATGGTTTA

AAACATGTTACAAAAGCAGGGGCTGTTTGGGCATTCTATACCTGCCTATGCTATTAACAATTTCCCCTAAAACTTGTGTTTATATTCTTGGTTTTGGGCA

CATATTTAAGCAAAGTTCCCTGCTCCCTCTGCAGTCAACACCAAAACTGGCAGTTTCCTACCTGGAGTACCTCCAACCTCTTCACAAGCCCAGTACAATA

TAAATGCATCTACCCCTTTCCTCTTAACCCTGGATTAGTAATGATCTCCCTTGAGAGCAGATAGGCCCCAGTGCCAATGTAAGAAAGACTCAGAATTAGG

AAATTTAAAAGTAGCCAAAGGAAAAGCAAATTCAAAATAGGACATAAACCTCAGACTTTTAATAAAAATATTCTCTCACTTT
Translation
MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPE TSLNQSNVTTEDMYTNGSPAPGSPAHAKGQEARRVRLIQFEKITEEPM GITLKLNEKQSCTVAR

ILHGGMIHRQG GSLHVGDEILEINGTNVTNHSVDQLQKAM KETKGMISLKVIANQQSRLPALQ MFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQI

INKDDSNWWQGRVEGSSKESAGLIPSPELQEW WRVASVAHSAPSEAPSCSPFGKKKKCKDKYLAKHSSI IFDQLDVVSYEEVVRLPAFKRKTLVLIG 

GASGVGRSHIKNGLLSHNPEKFAYPAPY - UNI18407 - YTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQD

KIAILDIEPQ TLKTVRTAELSPFIVFIAPTDQGTQ TEALQQLQKDSEAIRSQYAHYFDLSLVNNSVDETLKKLQEAFDQACSSPQWVPVSWVY
Transcript ENSMUST00000064027
Sequence
GATCCCTGCCTCCTCCGCCGCCTTAGTCTAGCTCGTCTCTGAACAGGCCGCAGTTCCCCGATTTGCGATTCCTGGGCTCAAAGCTCTGCGGCTACTGCGT

CTGGTTGTCTCTGCTCCTGAGAGATGACGCTCAAGTCGAGCGAAGGCGAGGGAGGGAACAGCATGCGCACCGCACTTTCGGACCTCTACCTGGAGCACTT

ACTACAGAAGCGTAACCGACCTGAG ACTTCATTGAACCAGTCAAATGTTACTACTGAGGACATGTACACCAATGGGTCCCCTGCTCCAGGTAGCCCTGC

CCATGCCAAAGGTCAGGAGGCTCGGAGAGTTCGTCTCATACAATTTGAGAAGATCACAGAAGAGCCCATG GGGATCACTTTGAAGCTGAATGAAAAACA

GTCGTGTACCGTGGCCAGAATTCTCCATGGCGGCATGATTCATAGACAAG GCTCCCTTCATGTTGGGGATGAGATCCTAGAAATCAATGGCACAAATGT

GACTAATCACTCAGTAGATCAGTTGCAGAAGGCAATG AAGGAAACCAAAGGAATGATCTCATTAAAAGTCATTGCTAATCAGCAGAGTCGCCTTCCTGC

GCTACAG ATGTTCATGAGAGCACAGTTTGACTATGATCCCCAAAAGGACAACCTTATTCCTTGCAAGGAGGCAGGACTGAAGTTTGTTACTGGAGACAT

TATCCAGATAATCAACAAAGATGACAG - UNI18407 - CATTTGGAATGCCACCTCCCCGCACCCCCTCCCTTGCTTAAGCCAAAAGGGTTGCTTCA

ACTTTTAG
Translation
MTLKSSEGEGGNSMRTALSDLYLEHLLQKRNRPE TSLNQSNVTTEDMYTNGSPAPGSPAHAKGQEARRVRLIQFEKITEEPM GITLKLNEKQSCTVAR

ILHGGMIHRQG GSLHVGDEILEINGTNVTNHSVDQLQKAM KETKGMISLKVIANQQSRLPALQ MFMRAQFDYDPQKDNLIPCKEAGLKFVTGDIIQI

INKDDS - UNI18407 - SIWNATSPHPLPCLSQKGCFNF

For any suggestions or comments, please send an email to unitrap@crg.es