Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031442 (Mcf2l)
Chromosomal location
Chr 8: 12873827 - 13020509 (+)
Description
mcf.2 transforming sequence-like Gene [Source:MGI (curated);Acc:Mcf2l-009]
RefSeq_dna
NM_178076 
RefSeq_peptide
NP_835177.1 
UniGene
Mm.334413 
MGI
MGI:103263 
Uniprot/SWISSPROT
Q64096 
Uniprot/SPTREMBL
Q80U26 Q9R1D0 Q9WVE6 Q3UHQ9 Q9WVD6 Q003U3 Q6PDM6 Q8C474 Q8C7Z1 
Human Ortholog
ENSG00000126217 (MCF2L)
Omim not available
UniTrap UNI17535
Vector Insertion
Chr 8: 12874017 - 12879881
Public Clones IST14603F11 (tigm) IST14140E3 (tigm)
Private Clones OST440976 (lexicon) OST433260 (lexicon) OST246207 (lexicon) OST126149 (lexicon)
OST49851 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36313
Vector Insertion
Chr 8: 12880151 - 12915330
Public Clones IST11720B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32384
Vector Insertion
Chr 8: 12916055 - 12926631
Public Clones IST12276F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33040
Vector Insertion
Chr 8: 12926734 - 12947952
Public Clones IST14961A9 (tigm) IST12991E5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32436
Vector Insertion
Chr 8: 12963248 - 12972978
Public Clones IST11925G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6446
Vector Insertion
Chr 8: 13002798 - 13003574
Public Clones CSA107 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000064464
Sequence
GTTTTGTTGAATCGGAGGATGAGGTTTTGGCTGAGAAATGAAGAGATGGCCCTAGAAGAAATGGTGCAGAGATTAAACGCGGTTTCCAAGAACACTG - 

UNI32384 - - UNI33040 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTA

CCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGT

TCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCT

CTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCT

CGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGT

CGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGC

AGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGA

GAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCA

CAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAA

GCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGC

TGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGC

CCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGAC

CACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGG

ATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAG

AAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAG

AAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGC

GCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCC

CTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACG

TGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCAC

ACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGG

AGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCT

CTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAAC

CTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCT

CCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGC

AAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGA

GAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGT

CGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGAT

TAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAG

CCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGA

AGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG CCTCTCCGACCAGTCCTGACAAAAAAGCTAAGCGGCACGAAGTAAAGAGCGA

CCCGACTCCCTTTGGTTTGCGAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTGAGGAACTCATCAA

CTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAGGGGGCCCTGACAC

CCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCAGCAGCAAGGAGGGATGGGT

GCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTGTGCGCGCCAGCTGTGCCCTGAG

CCTGCCGAGATCCTCAGCCCAGAGCCCGTTTAAAAGCAGAGGGGTTTCTAGGTGTGCAGAGCAAAGGGCCAGAGCCGAAGCCTGTCTCCACTGGTTTCCC

GCAGACTCCAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAGCTCCAGGGATAGTGGCCAGGCC

CCTGTGGCAGGCACTCGAGGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTTTTTTTTATTTTTAATTTTTATTTTTGCTTGGGCT

TGCTTAGTTTGGGAGGGGATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGGCTTCAGAGGACATTGGGGCCTTGGAACCAGGACC

CCACTGCATATGCAGATGCCAGGAGACAACAGTTCACCACCAAAGCTTCTTCAGAGACTCCAGAGTGGACAGAGGCGGGGCTGTGGGTCAGGAGACCCCT

GTGCAGGAAGCTGGGAGGCAGCCAACAGCCCCTGCTGTGCAGCCTCTCTAAGGTGTCCTGGCCTCTCTGGTGCTTTCTACGGCAACACGACCCTGAGGAA

GCCACTTCTAACAGGAGTGAACAGTTTGCTACCAACAGCCTAAGGGGGGGTCAAGGGACTCTCGTCTTTTATAAGTTTTTGATTTTTTTTAAACAGGGAT

TAACCCCATGGCCATTTTTTGTGGTACTCTGGCCTCAAAACTTTAACCAAGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATATAA

AACTATTTTTTGTTACTGGGGTTTACATCAAAGCACGTTGTTTATACAACTAACTGATTTCTGGGGCACTCTCGCTGAGACCTGGCACTCCCTGGAATAC

AGGTGCAGGAAGGCCTGGTCAGCCAGGGGGTGTGTCCTCCTGGGCAGCCAGGGGGCGTGTCCTCCACCAAAAGCAGTTGGAAATCATTGAGAGTCTTGCA

TCTGCATAGGTTTCGTTTTCACAAGAAATGTAAAGTATAATTTAAAATATTAGCCTTCTTTTCTACAATATAAAGGAGACTCTCTGTTTTTTAAAAGAAC

ATCATTAAATTAGGATATTTTTATTATTTTTAAAGAAAATGTATAACTCCATGCTGTCAGTCATCCTCAGCAACTCAGGCACTGGCTGCCTCTCCACGTC

AGGGCAGGCCCCACTTCCCCTCTCCTAGCCCCGTCCACTCTGCCCTACAGCAGGAGGGGCTGCAGCTGAGCTTGGGGTGGGGGACGGGGATCTGCAGCCT

CCATTCAAGTCACGGCAGAACTGCCACAAACTGTTGTTTTCCGCTTTTTTGTGTGTTTCAGAAACAAATTCTGTTCTTTGGAAACTCTCTGTGCCTAGTA

GGGCAGATATTTTTATATGTGTGTATATATGTTCACGTGTGTACATAGGATCTTGGTGTAAAGGATGTATTTATGGTCTCACGCTGCTGAACATGTGTCA

CTTTACGGTCCCTCCCTGTCTCCTCACCCTGCTGCCATGGGAGGCCACCGAGGCTCGTTCACCACTGTATGTCCAGGAAAAACACCCTCCTCCCCTGCCC

TATGGCTTGCAAAGCCATTACTGGCTACACCTTCAGAGAATGGT
Translation
 - UNI32384 - - UNI33040 -  - UNI32436 -     MLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLR

EPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAF

EEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAA

LQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446

 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQ

NKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRI

TKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAV

LFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHS

LPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKA ASPTSPDKKAKRHEVKSDPTPFGLRG GWSKTSHSLEAPEEDGGWSSA

EELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHC

ARQLCPEPAEILSPEPV
Transcript ENSMUST00000110863
Sequence
GAGCCGAGAGACTGAGGGCATGCTACCAACTACACGATGCTGCCCTGCCTTTATCACAGATGTTGCTGCTGCAGAGGGCGAGCGCTCCTGCCTCACACCC

CACAGACACCAGGGAGCCTTCACAAGCCTTGGAGATTTTCACCCGAAATTGTGATGTCATCAGGAGCCATTTTTTAATGTGGATGAACGCGGGACCTCAG

ATGCTAGGACTGACATGACGTGGGGGTCCTGAAGCTCGCTTTGATGGTCTGGTCAGCTGTCCGTGCAGCGCAGTAGGATGTCAGTCTGCCCCAGGAGGAG

GGGCTTCTGTTGATCTGTGAATCGATGCCGAGAAACAAACAACATACTGAAAGTATCCGTTCTCCTTTATCTAGAAGAAAGTCCTGGGAATTACAGGGTG

GGGCCTCTCGGGCCTTCGGAAGCCTGGTGCTGCTGAGACCTCTCTCGGGCATGCACTGTGGCACGTGGTGTGGAGATGGCATGGGACAGTGGGGTCACCA

GTGTCCATGGAAGCCAGGTCTGCTGCCAGCACATGCTGACTCCTAGTGTTTCTCCTTGTTTCAGTTTGCAAGATGCTGGCATTGGATTCATCTTGGTCAT

AGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCC

CACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCC

AGAACTACACGGCTACATTGATAAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAAT

TGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACC

AGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGA

GAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAG

GCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACC

TTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGA

AGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGT

GTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGAC

G TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGAT

TGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACA

CGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTG

CAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCT

GAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAG

AGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGC

AGAGATGGATAACCCCTTGATGGCACACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCAC

AACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGA

GAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCT

GAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGC

AGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCT

TGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCC

ATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACA

AGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATA

TCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAG

CACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGAC

CGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG ACGATGCGGTCCCTAGTTCTACCTCT

GAAAGCTCTGCGCTTTCCAGAAAGCGCTTCACGCTGCAGGGCTTGGCTAACCTCAAAGGTCAGAAAG CCTCTCCGACCAGTCCTGACAAAAAAGCTAAG

CGGCACGAAGTAAAGAGCGACCCGACTCCCTTTGGTTTGCGAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCC

AGTGCTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGAT

GAGAAAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACC

AGCAGCAAGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAG ACTCCAGCCCAGGG

TCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAGCTCCAGGGATAGTGGCCAGGCCCCTGTGGCAGGCACTCGA

GGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTTTTTTTTATTTTTAATTTTTATTTTTGCTTGGGCTTGCTTAGTTTGGGAGGGG

ATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGGCTTCAGAGGACATTGGGGCCTTGGAACCAGGACCCCACTGCATATGCAGATG

CCAGGAGACAACAGTTCACCACCAAAGCTTCTTCAGAGACTCCAGAGTGGACAGAGGCGGGGCTGTGGGTCAGGAGACCCCTGTGCAGGAAGCTGGGAGG

CAGCCAACAGCCCCTGCTGTGCAGCCTCTCTAAGGTGTCCTGGCCTCTCTGGTGCTTTCTACGGCAACACGACCCTGAGGAAGCCACTTCTAACAGGAGT

GAACAGTTTGCTACCAACAGCCTAAGGGGGGGTCAAGGGACTCTCGTCTTTTATAAGTTTTTGATTTTTTTTAAACAGGGATTAACCCCATGGCCATTTT

TTGTGGTACTCTGGCCTCAAAACTTTAACCAAGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATATAAAACTATTTTTTGTTACTG

GGGTTTACATCAAAGCACGTTGTTTATACAACTAACTGATTTCTGGGGCACTCTCGCTGAGACCTGGCACTCCCTGGAATACAGGTGCAGGAAGGCCTGG

TCAGCCAGGGGGTGTGTCCTCCTGGGCAGCCAGGGGGCGTGTCCTCCACCAAAAGCAGTTGGAAATCATTGAGAGTCTTGCATCTGCATAGGTTTCGTTT

TCACAAGAAATGTAAAGTATAATTTAAAATATTAGCCTTCTTTTCTACAATATAAAGGAGACTCTCTGTTTTTTAAAAGAACATCATTAAATTAGGATAT

TTTTATTATTTTTAAAGAAAATGTATAACTCCATGCTGTCAGTCATCCTCAGCAACTCAGGCACTGGCTGCCTCTCCACGTCAGGGCAGGCCCCACTTCC

CCTCTCCTAGCCCCGTCCACTCTGCCCTACAGCAGGAGGGGCTGCAGCTGAGCTTGGGGTGGGGGACGGGGATCTGCAGCCTCCATTCAAGTCACGGCAG

AACTGCCACAAACTGTTGTTTTCCGCTTTTTTGTGTGTTTCAGAAACAAATTCTGTTCTTTGGAAACTCTCTGTGCCTAGTAGGGCAGATATTTTTATAT

GTGTGTATATATGTTCACGTGTGTACATAGGATCTTGGTGTAAAGGATGTATTTATGGTCTCACGCTGCTGAACATGTGTCACTTTACGGTCCCTCCCTG

TCTCCTCACCCTGCTGCCATGGGAGGCCACCGAGGCTCGTTCACCACTGTATGTCCAGGAAAAACACCCTCCTCCCCTGCCCTATGGCTTGCAAAGCCAT

TACTGGCTACACCTTCAGAGAATGGTAATAAAATAAAAAACGTGCAAAGACTC
Translation
MAWDSGVTSVHGSQVCCQHMLTPSVSPCFSLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKV

P VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLAL

KEGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAH

VQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVD

KCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSP

G - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNP

LMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSL

DSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPM

QRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EA

SQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKD DDAVPSSTSESSALSRKRFTLQGLANLKGQKA ASPT

SPDKKAKRHEVKSDPTPFGLRG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAE

GLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSD DSSPGSAVLSSSSSFSEGYPAPFSELQG
Transcript ENSMUST00000110864
Sequence
AGTGACAGTGTGTCTGCTCTCCCTGCAGATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTG

CTTACCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAG

GAGTTCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGG

ACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACT

CTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGAT

AAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTG

AAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACA

CAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGG

CCCACAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGG

CAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGA

TAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACA

AGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTG

TGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGA

GGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGT

GCAGAAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAG

CAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAG

AGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAG

GGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG A

CACGTGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATG

GCACACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAGG AATATTCCTGCGGGA

 GAGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACG

CTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAA

ACCTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAG

CTCCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGAT

GCAAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCAC

GAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCT

GTCGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAG

ATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCAC

AGCCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTG

GAAGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGC

TGGTCCAGTGCTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATG

GATGATGAGAAAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGAC

CTGACCAGCAGCAAGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCC

ACTGTGCGCGCCAGCTGTGCCCTGAGCCTGCCGAGATCCTCAGCCCAGAGCCCGTTTAA
Translation
SDSVSALPADEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIG

FILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWL

CHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR R

LLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENR

HYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEY

ECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPYRR

AK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR NIPAG 

ESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEA

LSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN 

MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDR

KTDPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEG

AEGLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV
Transcript ENSMUST00000110866
Sequence
AGCCATTTTCTGGGGCATCCAGTGCTCCTTAGGTTGCCTGGCACTCACTCAGTGGGGACAAGTGGGCCTGGAGCCCTGTGCCTGAGCCAGGGTGGGAGAC

CTGAGGTTATCACAGCTGGTGGAGCAGGGGGATGTCGTGTTTGGGCACACACACTCGGCTCAAGCCTATCTGTGATCCATGAGACCCACAG ATGAAATC

ATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - UNI32436 - GTGGGCGGGG

ACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTCATGACCTATCTCACCAGCATC

CCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GC

ATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAG

TTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTG

GACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACC

GAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAG

TTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACCAGGACCAGCTGGACAATCAGG

CCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGC

TGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCC

ACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGA

TTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGG

CCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAA

ATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATTCAGGAGCTCAATGAGATTTAC

AAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAA

GCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - 

UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAA

CCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAGCTTCTGGACACCGAGCGGGCC

TACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTCATCTCAACAGGCCTGCAAAACAAGAAG

AACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATAGACTGCCCAGAGCTGGTGGGG

AGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGC

CCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGGATAACCAAGTACCAGCTGCTG

CTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCTCAAGGCTGTGAACGAC

TCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTCAGCGTGTGGACAGACCACAAG

AAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGG

AGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAGAGAACGTGAAGGGTGACACCA

AGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGG

TGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGCCCACGCCATCCAGCACCAG T

CCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGAGCTCATCGTTACCAAAGCCCC

CTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTGAGGAACTCATCAACTCATCTG

ATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAGGGGGCCCTGACACCCTTGCCA

TGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCAGCAGCAAGGAGGGATGGGTGCCAGCCA

GCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTGTGCGCGCCAGCTGTGCCCTGAGCCTGCCGA

GATCCTCAGCCCAGAGCCCGTTTAAAAGCAGAGGGGTTTCTAGGTGTGCAGAGCAAAGGGCCAGAGCCGAAGCCTGTCTCCACTGGTTTCCCGCAGACTC

CAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAGCTCCAGGGATAGTGGCCAGGCCCCTGTGGC

AGGCACTCGAGGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTTTTTTTTATTTTTAATTTTTATTTTTGCTTGGGCTTGCTTAGT

TTGGGAGGGGATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGGCTTCAGAGGACATTGGGGCCTTGGAACCAGGACCCCACTGCA

TATGCAGATGCCAGGAGACAACAGTTCACCACCAAAGCTTCTTCAGAGACTCCAGAGTGGACAGAGGCGGGGCTGTGGGTCAGGAGACCCCTGTGCAGGA

AGCTGGGAGGCAGCCAACAGCCCCTGCTGTGCAGCCTCTCTAAGGTGTCCTGGCCTCTCTGGTGCTTTCTACGGCAACACGACCCTGAGGAAGCCACTTC

TAACAGGAGTGAACAGTTTGCTACCAACAGCCTAAGGGGGGGTCAAGGGACTCTCGTCTTTTATAAGTTTTTGATTTTTTTTAAACAGGGATTAACCCCA

TGGCCATTTTTTGTGGTACTCTGGCCTCAAAACTTTAACCAAGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATATAAAACTATTT

TTTGTTACTGGGGTTTACATCAAAGCACGTTGTTTATACAACTAACTGATTTCTGGGGCACTCTCGCTGAGACCTGGCACTCCCTGGAATACAGGTGCAG

GAAGGCCTGGTCAGCCAGGGGGTGTGTCCTCCTGGGCAGCCAGGGGGCGTGTCCTCCACCAAAAGCAGTTGGAAATCATTGAGAGTCTTGCATCTGCATA

GGTTTCGTTTTCACAAGAAATGTAAAGTATAATTTAAAATATTAGCCTTCTTTTCTACAATATAAAGGAGACTCTCTGTTTTTTAAAAGAACATCATTAA

ATTAGGATATTTTTATTATTTTTAAAGAAAATGTATAACTCCATGCTGTCAGTCATCCTCAGCAACTCAGGCACTGGCTGCCTCTCCACGTCAGGGCAGG

CCCCACTTCCCCTCTCCTAGCCCCGTCCACTCTGCCCTACAGCAGGAGGGGCTGCAGCTGAGCTTGGGGTGGGGGACGGGGATCTGCAGCCTCCATTCAA

GTCACGGCAGAACTGCCACAAACTGTTGTTTTCCGCTTTTTTGTGTGTTTCAGAAACAAATTCTGTTCTTTGGAAACTCTCTGTGCCTAGTAGGGCAGAT

ATTTTTATATGTGTGTATATATGTTCACGTGTGTACATAGGATCTTGGTGTAAAGGATGTATTTATGGTCTCACGCTGCTGAACATGTGTCACTTTACGG

TCCCTCCCTGTCTCCTCACCCTGCTGCCATGGGAGGCCACCGAGGCTCGTTCACCACTGTATGTCCAGGAAAAACACCCTCCTCCCCTGCCCTATGGCTT

GCAAAGCCATTACTGGCTACACCTTCAGAGAATGGTAATAAAATAAAAAACGTGCAA
Translation
MRPTD DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFIL

VIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHR

T AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLA

QLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYA

VDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECI

LNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK 

SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELES

CIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALS

SILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MT

AVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKT

DPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAE

GLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV
Transcript ENSMUST00000110867
Sequence
AGTGGGCACTCCCCTGTGGGCACCGGGAGCCATTTTCTGGGGCATCCAGTGCTCCTTAGGTTGCCTGGCACTCACTCAGTGGGGACAAGTGGGCCTGGAG

CCCTGTGCCTGAGCCAGGGTGGGAGACCTGAGGTTATCACAGCTGGTGGAGCAGGGGGATGTCGTGTTTGGGCACACACACTCGGCTCAAGCCTATCTGT

GATCCATGAGACCCACAG ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGT

CTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAG

AATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTG

AAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGAC

ATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAG

CTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACA

GCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGA

AGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTG

TGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATC

AGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTT

TCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCG

CCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTT

CGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTT

CCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAAT

AAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGC

ACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTA

CCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACA

GGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATG

AATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTC

ATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGC

TGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAG

AGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTG

CAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATC

CTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGT

TCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGG

CCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCA

TCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAG

CAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTC

CTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCT

ACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCA

GTGCTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATG

AGAAAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCA

GCAGCAAGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAG GTGTGCAGAGCAAAG

GGCCAGAGCCGAAGCCTGTCTCCACTGGTTTCCCGCAGACTCCAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCT

CCCTTCTCCGAGCTCCAGGGATAGTGGCCAGGCCCCTGTGGCAGGCACTCGAGGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTT

TTTTTTATTTTTAATTTTTATTTTTGCTTGGGCTTGCTTAGTTTGGGAGGGGATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGG

CTTCAGAGGACATTGGGGCCTTGGAACCAGGACCCCACTGCATATGCAGATGCCAGGAGACAACAGTTCACCACC
Translation
MRPTD DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFIL

VIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHR

T AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLA

QLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYA

VDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECI

LNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK 

SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELES

CIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALS

SILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MT

AVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKT

DPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAE

GLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSG GVQSKGPEPKPVSTGFPQTPAQGQPC
Transcript ENSMUST00000110871
Sequence
TGGCACTCGGAGGACGGCACTGTGCAGCAAAGCCAGGGAGGCGTAGTATCCCCAAGCAGCAAGCAGCCCAAGATGGAGCTCCACTGCCTTCCTTTGTGTG

GCCCAGGCGGGCTGGCCGGCACACAGGTCATTGGATCCTGACCAGTGTGAAGGGTGACAGCATGACTTTGAGCCTCATCTCCGTGCTGTCCCAGGACGTC

ACAGCCCTGTGGCTCCTGCTGAAGACAAGTGCAG ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAG

CGCTTTGCTTACCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCC

GGACAAGGAGTTCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGA

CAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCA

GAGGACTCTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTA

CATTGATAAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCT

GATGGTGAAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGC

GCACACACAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAG

AGCGCGGCCCACAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAA

TTCTGGGCAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCC

CAGAAGATAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCT

GTGGACAAGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGC

ACCTCTGTGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGA

GCGACGAGGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGA

GACCGGTGCAGAAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTT

TCAGAAGCAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCC

CGACCAGAGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTC

CGCAGAGGGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTG

CGCAG ACACGTGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCC

CTTGATGGCACACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCT

GCGGGAGCTGGAGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAA

CAAGCCACGCTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTA

CCTGCTGAAACCTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGA

GGCGCTGAGCTCCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAA

GCTGCTGATGCAAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTG

TTTCTGCACGAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT 

ATGACGGCTGTCGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCA

ACCCCCGAGATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAG

CAGTCCCACAGCCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCG

CTCAGCCTGGAAGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG CACACTGGTCACATAGAAGGAGACCCCCTCATTTGTGGTCA

CCGGGTACCTCCACCAGGTGCACCCTAGGATGTTCAACTGCTCTGCCCACCTTCCTGAGCATGGGGCCATGGCCCCTTGCCCCTGCCATCCTCCCTCCCG

GATGCTATCTCTGCACTCTGTCTCTCCTCCCTCCTAGACGATGCGGTCCCTAGTTCTACCTCTGAAAGCTCTGCGCTTTCCAGAAAGCGCTTCACGCTGC

AGGGCTTGGCTAACCTCAAAGGTCAGAAAGGTAAAGAGGCAGTGCCCCCCCC
Translation
MTLSLISVLSQDVTALWLLLKTSAD DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVM

TYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQ

LTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAH

SVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAV

DKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLE

TGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSS

ENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGN

MEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK 

EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREEN

GEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSST

S SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKA AHWSHRRRPPHLWSPGTSTRCTLGCSTALPTFLSMGPWPLAPAILPPGCYLCTLSLL

PPRRCGP
Transcript ENSMUST00000098927
Sequence
AAGGCAACGCAATGGCAGAAAAGGGTGCGTCCCGGGGGGCCGGGCGGCGGTTCTGGTCACTATCAAGGAAGCGTCGGGGAGCACCAGGGCGCCACAAGCC

AG - UNI33040 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG

 - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAAT

GTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAG

GCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATT

GCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAGCTG

ACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCC

CAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGG

CCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGA

ACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGC

AGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCA

CGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCC

TGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGC

CTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCT

GCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAG

ATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACG

GAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCA

AGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGA

GAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATGAAT

GAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTCATC

TCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGC

ATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGC

CTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAG

AGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTG

GGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCC

TTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCG

TCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCA

CAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAGCAG

CGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTT

TGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACG

TGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTG

CTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGA

AAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTGGTAA
Translation
MAEKGASRGAGRRFWSLSRKRRGAPGRHKPD - UNI33040 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVIT

FPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP

 VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALK

EGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHV

QHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDK

CQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG

 - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPL

MAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLD

SYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQ

RHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EAS

QHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGP

KKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLW
Transcript ENSMUST00000110873
Sequence
CTCTGCAGCCAGCAGGACTCAGCTGCTGCCAGGCTCTCAACAGTTAATCATCTGCCAAGGGATAAGAGAGCTGATTCTAGCTCCTTAATCAGGACATCAA

ATCCGAATCTGAGGCCCTGGAAGAAGCAGCCGTGCGCCACTGCCGCCGCCGCTGCCGCAGCAGCCGCAGCCTGTGGCACTCGGAGGACGGCACTGTGCAG

CAAAGCCAGGGAGGCGTAGTATCCCCAAGCAGCAAGCAGCCCAAGATGGAGCTCCACTGCCTTCCTTTGTGTGGCCCAGGCGGGCTGGCCGGCACACAGG

TCATTGGATCCTGACCAGTGTGAAGGGTGACAGCATGACTTTGAGCCTCATCTCCGTGCTGTCCCAGGACGTCACAGCCCTGTGGCTCCTGCTGAAGACA

AGTGCAG ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - UNI32

436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTCATGAC

CTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGT

CCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCCTTCAA

GTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAGCTGACCGAGGA

CCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAGATGCT

GCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCAAAGTG

AAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACCAGGAC

CAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGAAGCTG

GAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGGATGTT

GGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGTCACTG

GAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTCTGAGG

TCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCTGGCCT

CGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATTCAGGA

GCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAGGAGAT

GTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGTCGCCC

TCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAGCCAAG

 AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAGCTTCT

GGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTCATCTCAACAGG

CCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATAGACTG

CCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTGTGGAG

GCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGGATAAC

CAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCT

CAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTCAGCGT

GTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCCTCTTC

TGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAGAGAAC

GTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGTGGGTG

AATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGCCCACG

CCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGAGCTCA

TCGTTACCAAAGCCCCCTGAGAAGGGCAAAG ACGATGCGGTCCCTAGTTCTACCTCTGAAAGCTCTGCGCTTTCCAGAAAGCGCTTCACGCTGCAGGGC

TTGGCTAACCTCAAAGGTCAGAAAG CCTCTCCGACCAGTCCTGACAAAAAAGCTAAGCGGCACGAAGTAAAGAGCGACCCGACTCCCTTTGGTTTGCGA

G GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGAC

GGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGAT

ATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCAGCAGCAAGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACC

CTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTGTGCGCGCCAGCTGTGCCCTGAGCCTGCCGAGATCCTCAGCCCAG

AGCCCGTTTAA
Translation
MTLSLISVLSQDVTALWLLLKTSAD DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVM

TYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQ

LTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAH

SVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAV

DKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLE

TGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSS

ENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGN

MEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK 

EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREEN

GEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSST

S SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKD DDAVPSSTSESSALSRKRFTLQGLANLKGQKA ASPTSPDKKAKRHEVKSDPTPFGL

RG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLW WYVRDLTSSKEGWVPA

SSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV
Transcript ENSMUST00000033819
Sequence
GTTTTGTTGAATCGGAGGATGAGGTTTTGGCTGAGAAATGAAGAGATGGCCCTAGAAGAAATGGTGCAGAGATTAAACGCGGTTTCCAAGAACACTG - 

UNI32384 - - UNI33040 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTA

CCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGT

TCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCT

CTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCT

CGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGT

CGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGC

AGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGA

GAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCA

CAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAA

GCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGC

TGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGC

CCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGAC

CACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGG

ATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAG

AAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAG

AAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGC

GCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCC

CTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACG

TGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCAC

ACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGG

AGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCT

CTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAAC

CTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCT

CCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGC

AAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGA

GAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGT

CGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGAT

TAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAG

CCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGA

AGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG ACGATGCGGTCCCTAGTTCTACCTCTGAAAGCTCTGCGCTTTCCAGAAAGCG

CTTCACGCTGCAGGGCTTGGCTAACCTCAAAGGTCAGAAAG CCTCTCCGACCAGTCCTGACAAAAAAGCTAAGCGGCACGAAGTAAAGAGCGACCCGAC

TCCCTTTGGTTTGCGAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTGAGGAACTCATCAACTCATC

TGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAGGGGGCCCTGACACCCTTGC

CATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCAGCAGCAAGGAGGGATGGGTGCCAGC

CAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTGTGCGCGCCAGCTGTGCCCTGAGCCTGCC

GAGATCCTCAGCCCAGAGCCCGTTTAAAAGCAGAGGGGTTTCTAGGTGTGCAGAGCAAAGGGCCAGAGCCGAAGCCTGTCTCCACTGGTTTCCCGCAGAC

TCCAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAGCTCCAGGGATAGTGGCCAGGCCCCTGTG

GCAGGCACTCGAGGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTTTTTTTTATTTTTAATTTTTATTTTTGCTTGGGCTTGCTTA

GTTTGGGAGGGGATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGGCTTCAGAGGACATTGGGGCCTTGGAACCAGGACCCCACTG

CATATGCAGATGCCAGGAGACAACAGTTCACCACCAAAGCTTCTTCAGAGACTCCAGAGTGGACAGAGGCGGGGCTGTGGGTCAGGAGACCCCTGTGCAG

GAAGCTGGGAGGCAGCCAACAGCCCCTGCTGTGCAGCCTCTCTAAGGTGTCCTGGCCTCTCTGGTGCTTTCTACGGCAACACGACCCTGAGGAAGCCACT

TCTAACAGGAGTGAACAGTTTGCTACCAACAGCCTAAGGGGGGGTCAAGGGACTCTCGTCTTTTATAAGTTTTTGATTTTTTTTAAACAGGGATTAACCC

CATGGCCATTTTTTGTGGTACTCTGGCCTCAAAACTTTAACCAAGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATATAAAACTAT

TTTTTGTTACTGGGGTTTACATCAAAGCACGTTGTTTATACAACTAACTGATTTCTGGGGCACTCTCGCTGAGACCTGGCACTCCCTGGAATACAGGTGC

AGGAAGGCCTGGTCAGCCAGGGGGTGTGTCCTCCTGGGCAGCCAGGGGGCGTGTCCTCCACCAAAAGCAGTTGGAAATCATTGAGAGTCTTGCATCTGCA

TAGGTTTCGTTTTCACAAGAAATGTAAAGTATAATTTAAAATATTAGCCTTCTTTTCTACAATATAAAGGAGACTCTCTGTTTTTTAAAAGAACATCATT

AAATTAGGATATTTTTATTATTTTTAAAGAAAATGTATAACTCCATGCTGTCAGTCATCCTCAGCAACTCAGGCACTGGCTGCCTCTCCACGTCAGGGCA

GGCCCCACTTCCCCTCTCCTAGCCCCGTCCACTCTGCCCTACAGCAGGAGGGGCTGCAGCTGAGCTTGGGGTGGGGGACGGGGATCTGCAGCCTCCATTC

AAGTCACGGCAGAACTGCCACAAACTGTTGTTTTCCGCTTTTTTGTGTGTTTCAGAAACAAATTCTGTTCTTTGGAAACTCTCTGTGCCTAGTAGGGCAG

ATATTTTTATATGTGTGTATATATGTTCACGTGTGTACATAGGATCTTGGTGTAAAGGATGTATTTATGGTCTCACGCTGCTGAACATGTGTCACTTTAC

GGTCCCTCCCTGTCTCCTCACCCTGCTGCCATGGGAGGCCACCGAGGCTCGTTCACCACTGTATGTCCAGGAAAAACACCCTCCTCCCCTGCCCTATGGC

TTGCAAAGCCATTACTGGCTACACCTTCAGAGAATGGT
Translation
MALEEMVQRLNAVSKNTD - UNI32384 - - UNI33040 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVIT

FPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP

 VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALK

EGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHV

QHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDK

CQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG

 - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPL

MAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLD

SYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQ

RHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EAS

QHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKD DDAVPSSTSESSALSRKRFTLQGLANLKGQKA ASPTS

PDKKAKRHEVKSDPTPFGLRG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEG

LW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV
Transcript ENSMUST00000064573
Sequence
GCAGCGGAGGACGATCTTCTGGGGATCGGTTTTGTTGAATCGGAGGATGAGGTTTTGGCTGAGAAATGAAGAGATGGCCCTAGAAGAAATGGTGCAGAGA

TTAAACGCGGTTTCCAAGAACACTG - UNI32384 - - UNI33040 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCC

AGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCA

GCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTC

ATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC CTGCCGCCGATGCAACGATGCAACGTCTCTCCAGTTTGGGTG

GCTGGATCCCCTTATGTTTGTTTGTCTGAGACTGACTGA
Translation
MRFWLRNEEMALEEMVQRLNAVSKNTD - UNI32384 - - UNI33040 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGR

GQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA LPPMQRCNVSPVWVAGSPYVCLSETD
Transcript ENSMUST00000110876
Sequence
GCAGCGGAGGACGATCTTCTGGGGATCGGTTTTGTTGAATCGGAGGATGAGGTTTTGGCTGAGAAATGAAGAGATGGCCCTAGAAGAAATGGTGCAGAGA

TTAAACGCGGTTTCCAAGAACACTG - UNI32384 - - UNI33040 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCC

AGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCA

GCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTCATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTC

ATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGG

CCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTG

CCAGAACTACACGGCTACATTGATAAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCA

ATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAA

CCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCA

GAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACCAGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGG

AGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCA

CCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGA

GAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAA

GTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAG

ACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAG

ATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATTCAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAA

CACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTG

TGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCT

CTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAG

AGAGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAGCTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCC

GCAGAGATGGATAACCCCTTGATGGCACACCTCATCTCAACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTC

ACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATAGACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTAT

GAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAG

CTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGGATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGG

GCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAAC

CTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTCAGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGC

CCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTA

CAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAGAGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTA

TATCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCC

AGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGCCCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAG

ACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGAGCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG ACGATGCGGTCCCTAGTTCTACCT

CTGAAAGCTCTGCGCTTTCCAGAAAGCGCTTCACGCTGCAGGGCTTGGCTAACCTCAAAGGTCAGAAAG CCTCTCCGACCAGTCCTGACAAAAAAGCTA

AGCGGCACGAAGTAAAGAGCGACCCGACTCCCTTTGGTTTGCGAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGT

CCAGTGCTGAGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATG

ATGAGAAAGGGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGA

CCAGCAGCAAGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTG

TGCGCGCCAGCTGTGCCCTGAGCCTGCCGAGATCCTCAGCCCAGAGCCCGTTTAAAAGCAGAGGGGTTTCTAGGTGTGCAGAGCAAAGGGCCAGAGCCGA

AGCCTGTCTCCACTGGTTTCCCGCAGACTCCAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAG

CTCCAGGGATAGTGGCCAGGCCCCTGTGGCAGGCACTCGAGGTCACCGTGCAGTAGACCAGCATGCAAATCTCTAAGTTTTTTGGTTTTTTTTTATTTTT

AATTTTTATTTTTGCTTGGGCTTGCTTAGTTTGGGAGGGGATGGTGCTCCGAGATCTCTGGAAACAGGAGGCCCCTGTCAGCCATGGGCTTCAGAGGACA

TTGGGGCCTTGGAACCAGGACCCCACTGCATATGCAGATGCCAGGAGACAACAGTTCACCACCAAAGCTTCTTCAGAGACTCCAGAGTGGACAGAGGCGG

GGCTGTGGGTCAGGAGACCCCTGTGCAGGAAGCTGGGAGGCAGCCAACAGCCCCTGCTGTGCAGCCTCTCTAAGGTGTCCTGGCCTCTCTGGTGCTTTCT

ACGGCAACACGACCCTGAGGAAGCCACTTCTAACAGGAGTGAACAGTTTGCTACCAACAGCCTAAGGGGGGGTCAAGGGACTCTCGTCTTTTATAAGTTT

TTGATTTTTTTTAAACAGGGATTAACCCCATGGCCATTTTTTGTGGTACTCTGGCCTCAAAACTTTAACCAAGAATCACTGTGTTTACATGAAATGACAA

TTTGATACTGTATTTGATATAAAACTATTTTTTGTTACTGGGGTTTACATCAAAGCACGTTGTTTATACAACTAACTGATTTCTGGGGCACTCTCGCTGA

GACCTGGCACTCCCTGGAATACAGGTGCAGGAAGGCCTGGTCAGCCAGGGGGTGTGTCCTCCTGGGCAGCCAGGGGGCGTGTCCTCCACCAAAAGCAGTT

GGAAATCATTGAGAGTCTTGCATCTGCATAGGTTTCGTTTTCACAAGAAATGTAAAGTATAATTTAAAATATTAGCCTTCTTTTCTACAATATAAAGGAG

ACTCTCTGTTTTTTAAAAGAACATCATTAAATTAGGATATTTTTATTATTTTTAAAGAAAATGTATAACTCCATGCTGTCAGTCATCCTCAGCAACTCAG

GCACTGGCTGCCTCTCCACGTCAGGGCAGGCCCCACTTCCCCTCTCCTAGCCCCGTCCACTCTGCCCTACAGCAGGAGGGGCTGCAGCTGAGCTTGGGGT

GGGGGACGGGGATCTGCAGCCTCCATTCAAGTCACGGCAGAACTGCCACAAACTGTTGTTTTCCGCTTTTTTGTGTGTTTCAGAAACAAATTCTGTTCTT

TGGAAACTCTCTGTGCCTAGTAGGGCAGATATTTTTATATGTGTGTATATATGTTCACGTGTGTACATAGGATCTTGGTGTAAAGGATGTATTTATGGTC

TCACGCTGCTGAACATGTGTCACTTTACGGTCCCTCCCTGTCTCCTCACCCTGCTGCCATGGGAGGCCACCGAGGCTCGTTCACCACTGTATGTCCAGGA

AAAACACCCTCCTCCCCTGCCCTATGGCTTGCAAAGCCATTACTGGCTACACCTTCAGAGAATGGTAATAAAATAAAAAACGTGCAAAGACTCAGTA
Translation
MRFWLRNEEMALEEMVQRLNAVSKNTD - UNI32384 - - UNI33040 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGR

GQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFN

RDEFKMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK

 EDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFT

DVGNSLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIF

LLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEAL

TKSPSPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE G

YAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQK

KLDHKLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVK

ELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQL

QACRE EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKD DDAVPSSTSESSALSRKRFTLQGLANLKG

QKA ASPTSPDKKAKRHEVKSDPTPFGLRG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMV

EVVEEGAEGLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV
Transcript ENSMUST00000110879
Sequence
GCTTCCTTCTCGTAGACCTGTGTCTTAGGTCTGGCACCGCCCTTGCTGGGAGAGTCAAGTCTTGACCCAGCTACCCACCGTCTCCCTCTTACCTGGGCAT

GAGACCTCGTGGAGAGCGCGCTCTAGGCTGCTGTGGACTCTGCACCTGCCCTGCAGCGGCGGGAG - UNI32384 - - UNI33040 - ATGAAATC

ATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - UNI32436 - GTGGGCGGGG

ACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTCATGACCTATCTCACCAGCATC

CCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCATCCGTCCTGCGGATAGCC GC

ATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCCTTCAAGTTCAACAGAGATGAG

TTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAGCTGACCGAGGACCTCGGGGGGACCCTG

GACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAGATGCTGCAGGCCTTTGGGACC

GAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCAAAGTGAAG GAAGATCTGCAG

TTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACCAGGACCAGCTGGACAATCAGG

CCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGAAGCTGGAACAGTGCCTGCAGC

TGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGGATGTTGGCAACAGCCTGGCCC

ACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGTCACTGGAAGGTCAGCAGCTGA

TTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTCTGAGGTCACCAGGAGGCGGGG

CCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCTGGCCTCGCAGCCTGTGGACAA

ATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATTCAGGAGCTCAATGAGATTTAC

AAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAGGAGATGTTCCACCGCAGGCAA

GCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGTCGCCCTCCCCCTCGCCAG - 

UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAGCCAAG AGCGAAATGAGTGAA

CCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAGCTTCTGGACACCGAGCGGGCC

TACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTCATCTCAACAGGCCTGCAAAACAAGAAG

AACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATAGACTGCCCAGAGCTGGTGGGG

AGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTGTGGAGGCAGTGCTCTGACTGC

CCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGGATAACCAAGTACCAGCTGCTG

CTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGCATCCTCAAGGCTGTGAACGAC

TCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTCAGCGTGTGGACAGACCACAAG

AAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCCTCTTCTGCAAGAAGAGGGAGG

AGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAGAGAACGTGAAGGGTGACACCA

AGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGTGGGTGAATGAGATTCGGAAGG

TGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGCCCACGCCATCCAGCACCAG T

CCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGAGCTCATCGTTACCAAAGCCCC

CTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTGAGGAACTCATCAACTCATCTG

ATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAGGGGGCCCTGACACCCTTGCCA

TGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTGGTAA
Translation
MRPRGERALGCCGLCTCPAAAGD - UNI32384 - - UNI33040 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDG

SPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAGIGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEF

KMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSRWLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDL

QLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGN

SLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIENRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLAS

QPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYKEYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSP

SPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPYRRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAE

MDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFLRELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDH

KLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDLQEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELAR

FKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACR

E EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKLEDRKTDPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEED

GGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVVEEGAEGLW
Transcript ENSMUST00000095456
Sequence
CGCAACGGTCGCCTCAGTCCTCAGCGCCGCTGCCCCTCCCCCACCCTCGCTCCCGCTCCCGCCTTCCCGTCTCCTCCCTCCCAGTCTCAGTGGCCCCAGA

CCGACCGGCGGGCGGAGTCTGGGAGTGTGGCACCTGCGAGTAAGTGAGCTTGCTGGATGAGGAGGAGAAGACAGTCCCCAGCACTAGCAG - UNI1753

5 - AATAAATGCTAAAGACTGCAGCTAGTGGTTTTGTTCTTGTCCGAAGAAGCAATCCTTCGATCTGCACCTTGACCTCATGTTCCCTTGACATCACAG

CCTCATGTCCGACTGCTGGTGCTTCATCTTCTGCAAGGAACACGTTAGAAGCAATCCTCTGTCACCACAGCATGATGGGGCCTCAAGGGAGGAGGCTGAT

CACCAGGTGGACGTGTCTGATGGCATCAGGCTGGTTCCAGACAAAGCAGAGGCCACGGCTGCTACAGCCTCAG - UNI32384 - - UNI33040 - 

- UNI36313 - ATGAAATCATGCACCAGGACATCGTCCCGCTCTGTGCCGCTGACATCCAGGAGCAGCTGAAGAAGCGCTTTGCTTACCTGTCTG - 

UNI32436 - GTGGGCGGGGACAGGACGGAAGCCCAGTCATCACCTTCCCTGACTACCCAGCCTTCAGCGAGATCCCGGACAAGGAGTTCCAGAATGTC

ATGACCTATCTCACCAGCATCCCCAG TTTGCAAGATGCTGGCATTGGATTCATCTTGGTCATAGACCGAAGGCAGGACAAATGGACCTCTGTGAAGGCA

TCCGTCCTGCGGATAGCC GCATCTTTCCCAGCCAACCTGCAGCTTGTCCTTGTTCTTCGGCCCACGGGCTTTTTCCAGAGGACTCTCTCGGACATTGCC

TTCAAGTTCAACAGAGATGAGTTTAAGATGAAAGTGCCG GTCATGATGCTAAGCTCAGTGCCAGAACTACACGGCTACATTGATAAGTCGCAGCTGACC

GAGGACCTCGGGGGGACCCTGGACTACTGCCACTCCAGGTGGCTGTGCCACCGCACA GCAATTGAAAGCTTCGCCCTGATGGTGAAGCAGACAGCCCAG

ATGCTGCAGGCCTTTGGGACCGAGCTGGCTGAAACAGAGCTGCCGAATGACGTCCAGTCAACCAGCCTGGTGCTCAGCGCACACACAGAGAAGAAGGCCA

AAGTGAAG GAAGATCTGCAGTTAGCACTGAAGGAGGGGAACAGCATCCTGGAGAGCCTCAGAGAGCCACTGGCTGAGAGCGCGGCCCACAGTGTGAACC

AGGACCAGCTGGACAATCAGGCCACCGTGCAGAG GCTCCTGGCCCAGCTGAATGAGACGGAGGCTGCCTTTGACGAATTCTGGGCAAAGCATCAGCAGA

AGCTGGAACAGTGCCTGCAGCTGCGGCATTTTGAGCAAGGTTTCCGGGAG GTCAAAACCACCTTGGATTCCATGTCCCAGAAGATAGCTGCTTTCACGG

ATGTTGGCAACAGCCTGGCCCACGTGCAGCACCTTCTGAAGGACTTGACCGCCTTTGAGGAGAAGTCCAGT GTGGCTGTGGACAAGGCCCGCGCCCTGT

CACTGGAAGGTCAGCAGCTGATTGAGAACAGGCACTACGCTGTGGACTCCATCCACCCCAAGTGTGAAGAGCTCCAGCACCTCTGTGACCACTTCGCCTC

TGAGGTCACCAGGAGGCGGGGCCTGCTCAGCAAGTCCTTGGAGCTGCATAGCCTCCTGGAGACG TCCATGAAGTGGAGCGACGAGGGGATCTTCCTGCT

GGCCTCGCAGCCTGTGGACAAATGCCAGTCCCAGGATGGCGCAGAGGCGGCCCTCCAGGAGATTGAGAAGTTTCTGGAGACCGGTGCAGAAAATAAGATT

CAGGAGCTCAATGAGATTTACAAGGAATACGAATGCATCCTCAACCAGGACCTTCTG GAACACGTGCAAAAAGTCTTTCAGAAGCAAGAAAGCACGGAG

GAGATGTTCCACCGCAGGCAAGCCAGCCTGAAGAAACTGGCAGCCAAGCAGACACGGCCTGTGCAGCCCGTGGCCCCCCGACCAGAGGCGCTTACCAAGT

CGCCCTCCCCCTCGCCAG - UNI6446 - GCTCCTGGCGAAGCTCTGAGAACTCCAGCTCTGAGGGCAACGCACTCCGCAGAGGGCCCTACAGGAGAG

CCAAG AGCGAAATGAGTGAACCCCGGCAGGGCCGCACCAGCTCCACAGGGGAAGAGGAAGAGAGCCTGGCCATCCTGCGCAG ACACGTGATGAATGAG

CTTCTGGACACCGAGCGGGCCTACGTGGAGGAGCTGCTCTGTGTCTTAGAG GGCTATGCCGCAGAGATGGATAACCCCTTGATGGCACACCTCATCTCA

ACAGGCCTGCAAAACAAGAAGAACATTCTGTTTGGAAACATGGAGGAAATCTATCATTTTCACAACAG AATATTCCTGCGGGAGCTGGAGAGCTGCATA

GACTGCCCAGAGCTGGTGGGGAGGTGCTTTCTGGAAAGG ATGGAGGAGTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCACGCTCTGAGAGCCTG

TGGAGGCAGTGCTCTGACTGCCCCTTCTTCCAG GAGTGTCAGAAGAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAACCTGTGCAGAGG

ATAACCAAGTACCAGCTGCTGCTCAAG GAAATGCTGAAGTACAGCAAGCACTGTGAAGGGGCAGAGGACCTGCAGGAGGCGCTGAGCTCCATCCTGGGC

ATCCTCAAGGCTGTGAACGACTCCATGCATCTCATCGCCATCACTGGCTATGAT GGAAACCTTGGCGACCTGGGGAAGCTGCTGATGCAAGGTTCCTTC

AGCGTGTGGACAGACCACAAGAAGGGCCACACCAAAGTGAAGGAGCTAGCCAGGTTCAAGCCCATGCAGCGGCACCTGTTTCTGCACGAGAAGGCCGTCC

TCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGATACGAGAAGGCTCCTTCCTACAGCTACAAGCAGTCCTTGAAT ATGACGGCTGTCGGCATCACAG

AGAACGTGAAGGGTGACACCAAGAAGTTCGAGATCTGGTACAACGCAAGGGAGGAGGTTTATATCATTCAG GCGCCAACCCCCGAGATTAAAGCAGCGT

GGGTGAATGAGATTCGGAAGGTGCTGACCAGCCAGCTGCAGGCTTGCCGGG AGGCCAGCCAGCACCGAGCCCTGGAGCAGTCCCACAGCCTTCCTTTGC

CCACGCCATCCAGCACCAG TCCCACAAAAGGGAACACAAGAAATGTCAAGAAGCTCGAAGACCGGAAGACGGACCCGCTCAGCCTGGAAGGCTACGTGA

GCTCATCGTTACCAAAGCCCCCTGAGAAGGGCAAAG GCTGGAGCAAAACATCCCACTCCCTGGAGGCCCCTGAGGAGGACGGAGGCTGGTCCAGTGCTG

AGGAACTCATCAACTCATCTGATGCTGAGGAAGACGGTGGAGTGGGCCCTAAGAAGCTG GTGCCGGGTAAATACACAGTGGTGATGGATGATGAGAAAG

GGGGCCCTGACACCCTTGCCATGAGGAGTGGAGATATGGTGGAGGTGGTGGAAGAAGGCGCTGAGGGCCTCTG GTATGTTCGGGACCTGACCAGCAGCA

AGGAGGGATGGGTGCCAGCCAGCAGCCTATCCACCCTCCTGGGCAAATCCAGTTCAGCCCAGTGTCTGAGCAGCTCAGGTAAGATCCACTGTGCGCGCCA

GCTGTGCCCTGAGCCTGCCGAGATCCTCAGCCCAGAGCCCGTTTAAAAGCAGAGGGGTTTCTAGGTGTGCAGAGCAAAGGGCCAGAGCCGAAGCCTGTCT

CCACTGGTTTCCCGCAGACTCCAGCCCAGGGTCAGCCGTGCTGAGCAGCTCATCCAGCTTCAGCGAGGGCTACCCTGCTCCCTTCTCCGAGCTCCAGGGA

TAGTGGCCAGGCCCCTGTGGCAGGCACTCGAG
Translation
 - UNI17535 - MSDCWCFIFCKEHVRSNPLSPQHDGASREEADHQVDVSDGIRLVPDKAEATAATASD - UNI32384 - - UNI33040 - - 

UNI36313 - DEIMHQDIVPLCAADIQEQLKKRFAYLSG - UNI32436 - GGRGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPS SLQDAG

IGFILVIDRRQDKWTSVKASVLRIA ASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDEFKMKVP VMMLSSVPELHGYIDKSQLTEDLGGTLDYCHSR

WLCHRT AIESFALMVKQTAQMLQAFGTELAETELPNDVQSTSLVLSAHTEKKAKVK EDLQLALKEGNSILESLREPLAESAAHSVNQDQLDNQATVQR

 RLLAQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFRE VKTTLDSMSQKIAAFTDVGNSLAHVQHLLKDLTAFEEKSS VAVDKARALSLEGQQLIE

NRHYAVDSIHPKCEELQHLCDHFASEVTRRRGLLSKSLELHSLLET SMKWSDEGIFLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNEIYK

EYECILNQDLL EHVQKVFQKQESTEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPSPSPG - UNI6446 - GSWRSSENSSSEGNALRRGPY

RRAK SEMSEPRQGRTSSTGEEEESLAILRR RHVMNELLDTERAYVEELLCVLE GYAAEMDNPLMAHLISTGLQNKKNILFGNMEEIYHFHNR RIFL

RELESCIDCPELVGRCFLER MEEFQIYEKYCQNKPRSESLWRQCSDCPFFQ ECQKKLDHKLSLDSYLLKPVQRITKYQLLLK EMLKYSKHCEGAEDL

QEALSSILGILKAVNDSMHLIAITGYD GNLGDLGKLLMQGSFSVWTDHKKGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQS

LN MTAVGITENVKGDTKKFEIWYNAREEVYIIQ APTPEIKAAWVNEIRKVLTSQLQACRE EASQHRALEQSHSLPLPTPSSTS SPTKGNTRNVKKL

EDRKTDPLSLEGYVSSSLPKPPEKGKG GWSKTSHSLEAPEEDGGWSSAEELINSSDAEEDGGVGPKKL VPGKYTVVMDDEKGGPDTLAMRSGDMVEVV

EEGAEGLW WYVRDLTSSKEGWVPASSLSTLLGKSSSAQCLSSSGKIHCARQLCPEPAEILSPEPV

For any suggestions or comments, please send an email to unitrap@crg.es