Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031467 (Agpat5)
Chromosomal location
Chr 8: 18846537 - 18881972 (+)
Description
1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) Gene [Source:MGI (curated);Acc:Agpat5-001]
RefSeq_peptide
NP_081068.1 
UniGene
Mm.24117 
MGI
MGI:1196345 
Uniprot/SWISSPROT
Q9D1E8 
Uniprot/SPTREMBL
Q3TDP3 
Human Ortholog
ENSG00000155189 (AGPAT5)
Omim not available
UniTrap UNI31647
Vector Insertion
Chr 8: 18846779 - 18861476
Public Clones (sanger) IST13606B6 (tigm) IST14972H1 (tigm) IST11033A1 (tigm) IST10830D5 (tigm)
IST10261B2 (tigm) IST10928H10 (tigm) IST11206H5 (tigm) IST14183G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16963
Vector Insertion
Chr 8: 18861547 - 18868892
Public Clones not available
Private Clones OST451787 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18197
Vector Insertion
Chr 8: 18869009 - 18870837
Public Clones not available
Private Clones OST427706 (lexicon) OST62319 (lexicon)
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033847
Sequence
GTCGCGGCTGGCGAGCCGAGAGGATGCTGCTGTCCCTGGTGCTCCACACGTACTCTATGCGCTACCTGCTCCCCAGCGTCCTGTTGCTGGGCTCGGCGCC

CACCTACCTGCTGGCCTGGACGCTGTGGCGGGTGCTCTCCGCGCTGATGCCCGCCCGCCTGTACCAGCGCGTGGACGACCGGCTTTACTGCGTCTACCAG

AACATGGTGCTCTTCTTCTTCGAGAACTACACCGGGGTCCAG - UNI31647 - ATATTGCTATATGGAGATTTGCCAAAAAATAAAGAAAATGTAAT

ATATCTAGCGAATCATCAAAGCACAG - UNI16963 - TTGACTGGATTGTTGCGGACATGCTGGCTGCCAGACAGGATGCCCTAGGACATGTGCGCT

ACGTACTGAAAGACAAGTTAAAATGGCTTCCGCTGTATGGGTTCTACTTTGCTCAG - UNI18197 - CATGGAGGAATTTATGTAAAACGAAGTGCC

AAATTTAATGATAAAGAAATGAGAAGCAAGCTGCAGAGCTATGTGAACGCAGGAACACCG ATGTATCTTGTGATTTTCCCAGAGGGAACAAGGTATAAT

GCAACATACACAAAACTCCTTTCAGCCAGTCAGGCATTTGCTGCTCAGCGGG GCCTTGCAGTATTAAAACACGTACTGACACCAAGAATAAAGGCCACT

CACGTTGCTTTTGATTCTATGAAGAGTCATTTAGATGCAATTTATGATGTCACAGTGGTTTATGAAGGGAATGAGAAAGGTTCAGGAAAATACTCAAATC

CACCATCCATGACTG AGTTTCTCTGCAAACAGTGCCCAAAACTTCATATTCACTTTGATCGTATAGACAGAAATGAAGTTCCAGAGGAACAAGAACACA

TGAAAAAGTGGCTTCATGAGCGCTTTGAGATAAAAGATAG GTTGCTCATAGAGTTCTATGATTCACCAGATCCAGAAAGAAGAAACAAATTTCCTGGGA

AAAGTGTTCATTCCAGACTAAGTGTGAAGAAGACTTTACCTTCAGTGTTGATCTTGGGGAGTTTGACTGCTGTCATGCTGATGACGGAGTCCGGAAGGAA

ACTGTACATGGGCACCTGGTTGTATGGAACCCTCCTTGGCTGCCTGTGGTTTGTTATTAAAGCATAAGCAAGTAGC
Translation
MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQNMVLFFFENYTGVQ - UNI31647 - ILLYGDLPKNKEN

VIYLANHQSTV - UNI16963 - VDWIVADMLAARQDALGHVRYVLKDKLKWLPLYGFYFAQ - UNI18197 - HGGIYVKRSAKFNDKEMRSKLQ

SYVNAGTP MYLVIFPEGTRYNATYTKLLSASQAFAAQRG GLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDVTVVYEGNEKGSGKYSNPPSMTE EFL

CKQCPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDR RLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTW

LYGTLLGCLWFVIKA

For any suggestions or comments, please send an email to unitrap@crg.es