Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031481 (Tpte)
Chromosomal location
Chr 8: 23393913 - 23481890 (+)
Description
transmembrane phosphatase with tensin homology Gene [Source:MGI Symbol;Acc:MGI:2446460]
RefSeq_dna
NM_199257 
RefSeq_peptide
NP_954866.1 
MGI
MGI:2446460 
Uniprot/SPTREMBL
Q91X02 Q91X01 Q3KNE1 Q91X03 
Human Ortholog
ENSG00000166157 (TPTE)
Omim not available
UniTrap UNI33988
Vector Insertion
Chr 8: 23447032 - 23455456
Public Clones IST13335H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033870
Sequence
ATGCATTTTGGGAACATAAATAGCACTAATTGG TTTTTTAGAGACAAAAAGCACCA AAATAAAAAGGTGTCAGTGAGTGCTTCAAGGACCATTAAACT

AAATGGCAGCACTGG CTACGACACAAATGAACAGATAACACTAATCACTAACGGGAGCAG TTTGTCATATCCAGATGAAATAAAATCAGCAAGTTATG

CGGACCCCATCAGTACAAA AGCATATACAAATGATTCGTCAGTATACGACCCTGGGGGAGCTTCGAGCAG CACAACCCTGTATGAACTGAATTCCTTG

AGTGAAGTATCGAAAGAAAT CATTACCCAGGGAGAATCTGCTTTACTACGTGATAAAGAAGCTACCAGCGAACT CAAAATCCCAAGTACACTGCAAAC

GCAGACGTCCATGTCCACCAACACTCT CTCCTTATCTGATTTATCATCAGATTACCAGGAAGAGCAAATGAACAAATG CAAGTTAAACCAGATGTCCA

AGTTGTACGACGATGATGAACGTACTGATATTCAAAAGTCATACTG GAATGTGGTTAAGAAATTTGTGCGCATCCTTGTGTCCTCGGTTGCCTTCAG A

ATATTTGGAATTTTCCTGGTCATTCTGGATGTATTTCTTGTGGTTGTCGATCTAAATGTCTCTGAAAAGAAAATTTATATTCCTTTGGACTATCGTTCCA

TTTCTTTAGCGATTGCTTTATTTTTCCTCGTGGATGTTCTTCTTAGAGTGTCTGTAGAAGG GAGACGGCGCTATTTCTCTGACGTACTGAACACCCTAG

ACGCTGTGGTCATCGGTGTGACTGTGGTTGTGGCTGTCATTTATGCACTTTATGACAAACACTTTCTCAGAGATATCCCAAG ACTGGCAGTTTTACTGC

GGCCTCTACGACTGCTCATTCTGATAAGGATTCTGCAACTGGCTCATCAAAAGAGACAACTCGAAAGGCTGACCAGGAAGCTG GTATCGGGTAACAAGC

GACGCTACAAGAAGGATGGCTTTGACCTAGACCTCACTTACGTCACTG AGCGTATTATTGCCATGTCATTTCCATCGTCTGGAAGGGAGTCCTTCTACA

GAAATCCAATCAAG - UNI33988 - GAGGTTGTGCGGTTCCTGGATACCAAGCACCCAAACCACTATCAAGTCTACAATCTATGCA GTGAGAGAGC

TTATGACCCTAAGCACTTCCACTACAGGGTCCGCAGAATCATGATTGATGATCATAATGTCCCCACTCTTGA GGAAATGTTGTTGTTCTCCAAGGAAGT

AAATAATTGGATGGCTCAAGATCCTGAAAATGTTGTCGCGATTCACTGTAAGGGAGGAAAAG GAAGAACTGGAACCATGGTGTGTGCCTGCCTCATTGC

CAGTGAAATAGTTTTAAATGCAAAG GAAAGTCTGTACTTTTTTGGAGAGCGGCGGACAGATAAAAGCAACAGCTCGAAGTTCCAAGGAATAGAGACCCC

TTCTCAG AATAGATATGTGAAATATTTTGAAAAACTGAAAATTAACTACCAACTAACTCTCCCTCCCAAAAAAGTACTCGTGATAAAAAGATTGGTCGT

TTATTCCATTCATG GCGTTGGAAAAGGCGACGGGAGTGACCTGGAAGTACAAATCATAATGTGGCAGGAGACTGTTTTTTCCTTTTGTAATTCCAGGAA

TTGTATG ATATTTCATGACCCTGAAACAGACAGAGCAATAATCAATGTGTTCCATTGCCCGGCTCTATACGATGATGTGAAAGTGAAATTTCTCTCTCC

G AATCTTCCTAAATACTATGATGACTGCCCCTTTTTCTTTTGGTTTCATACATCTTTTATTAAAAATAACAG GCTTTATCTACCAAGAAACGAATTGG

ATAATACCCATAAACCAAAAACATGGAAAATTTATGGTGAAAAGTTTGCAGTAGAGGTGGATTTTGGTGAGAACTAG
Translation
MHFGNINSTNW FFRDKKHQ QNKKVSVSASRTIKLNGSTG GYDTNEQITLITNGSS SLSYPDEIKSASYADPISTK KAYTNDSSVYDPGGASSS S

TTLYELNSLSEVSKEI IITQGESALLRDKEATSEL LKIPSTLQTQTSMSTNTL LSLSDLSSDYQEEQMNKC CKLNQMSKLYDDDERTDIQKSYW W

NVVKKFVRILVSSVAFR RIFGIFLVILDVFLVVVDLNVSEKKIYIPLDYRSISLAIALFFLVDVLLRVSVEG GRRRYFSDVLNTLDAVVIGVTVVVAV

IYALYDKHFLRDIPR RLAVLLRPLRLLILIRILQLAHQKRQLERLTRKL VSGNKRRYKKDGFDLDLTYVTE ERIIAMSFPSSGRESFYRNPIK - U

NI33988 - EVVRFLDTKHPNHYQVYNLCS SERAYDPKHFHYRVRRIMIDDHNVPTLE EEMLLFSKEVNNWMAQDPENVVAIHCKGGKG GRTGTMV

CACLIASEIVLNAK ESLYFFGERRTDKSNSSKFQGIETPSQ NRYVKYFEKLKINYQLTLPPKKVLVIKRLVVYSIHG GVGKGDGSDLEVQIIMWQET

VFSFCNSRNCM IFHDPETDRAIINVFHCPALYDDVKVKFLSP NLPKYYDDCPFFFWFHTSFIKNNR RLYLPRNELDNTHKPKTWKIYGEKFAVEVDF

GEN
Transcript ENSMUST00000068928
Sequence
CGACCCTGGACATGGGAACTTTTAGATCAGCATATGTGGGACTACCCTTGTTTCTGGCTATGAACTGACTGATTTCGTTGACTTACCAAGCTTAATTTGG

GGGAAAATTAAAAAGAAAAGAGAATGAAAAAGAGGAAAAGCTGTTATTCTGAAGGGCAGCCGGAGAAAAGACTGGCAGCAGGAACTGGAGTGGACTCAGC

TCCCCCTTCGGGTCGAGGGGTAGCTAAGCTGTAAGACTCTAACTTGTGGGTCCCTCTGTCCGGCCCTGCTGCAGGGTCTTACTGGGGCTTTAGCGACTTC

TGAGCCCAAGCAGCCCAGAAAAAAAAAGCAGTGCCTTCAG ATTAATTGTAAGTTAAGTTGAATCACAAGACAATACCATGTATGGAGAAAAGAAGAGCC

ATTTGTATCTCTGGATGGAACACTATGGGTATGACAT GCCTGCAAATATTTACAAGATGTATTCTCAGCCCTCCAGAAAAACGGATGATGC AAATAAA

AAGGTGTCAGTGAGTGCTTCAAGGACCATTAAACTAAATGGCAGCACTGG CTACGACACAAATGAACAGATAACACTAATCACTAACGGGAGCAG TTT

GTCATATCCAGATGAAATAAAATCAGCAAGTTATGCGGACCCCATCAGTACAAA AGCATATACAAATGATTCGTCAGTATACGACCCTGGGGGAGCTTC

GAGCAG CACAACCCTGTATGAACTGAATTCCTTGAGTGAAGTATCGAAAGAAAT CATTACCCAGGGAGAATCTGCTTTACTACGTGATAAAGAAGCTA

CCAGCGAACT CAAAATCCCAAGTACACTGCAAACGCAGACGTCCATGTCCACCAACACTCT CTCCTTATCTGATTTATCATCAGATTACCAGGAAGAG

CAAATGAACAAATG CAAGTTAAACCAGATGTCCAAGTTGTACGACGATGATGAACGTACTGATATTCAAAAGTCATACTG GAATGTGGTTAAGAAATT

TGTGCGCATCCTTGTGTCCTCGGTTGCCTTCAG AATATTTGGAATTTTCCTGGTCATTCTGGATGTATTTCTTGTGGTTGTCGATCTAAATGTCTCTGA

AAAGAAAATTTATATTCCTTTGGACTATCGTTCCATTTCTTTAGCGATTGCTTTATTTTTCCTCGTGGATGTTCTTCTTAGAGTGTCTGTAGAAGG GAG

ACGGCGCTATTTCTCTGACGTACTGAACACCCTAGACGCTGTGGTCATCGGTGTGACTGTGGTTGTGGCTGTCATTTATGCACTTTATGACAAACACTTT

CTCAGAGATATCCCAAG ACTGGCAGTTTTACTGCGGCCTCTACGACTGCTCATTCTGATAAGGATTCTGCAACTGGCTCATCAAAAGAGACAACTCGAA

AGGCTGACCAGGAAGCTG GTATCGGGTAACAAGCGACGCTACAAGAAGGATGGCTTTGACCTAGACCTCACTTACGTCACTG AGCGTATTATTGCCAT

GTCATTTCCATCGTCTGGAAGGGAGTCCTTCTACAGAAATCCAATCAAG - UNI33988 - GAGGTTGTGCGGTTCCTGGATACCAAGCACCCAAACC

ACTATCAAGTCTACAATCTATGCA GTGAGAGAGCTTATGACCCTAAGCACTTCCACTACAGGGTCCGCAGAATCATGATTGATGATCATAATGTCCCCA

CTCTTGA GGAAATGTTGTTGTTCTCCAAGGAAGTAAATAATTGGATGGCTCAAGATCCTGAAAATGTTGTCGCGATTCACTGTAAGGGAGGAAAAG GA

AGAACTGGAACCATGGTGTGTGCCTGCCTCATTGCCAGTGAAATAGTTTTAAATGCAAAG GAAAGTCTGTACTTTTTTGGAGAGCGGCGGACAGATAAA

AGCAACAGCTCGAAGTTCCAAGGAATAGAGACCCCTTCTCAG AATAGATATGTGAAATATTTTGAAAAACTGAAAATTAACTACCAACTAACTCTCCCT

CCCAAAAAAGTACTCGTGATAAAAAGATTGGTCGTTTATTCCATTCATG GCGTTGGAAAAGGCGACGGGAGTGACCTGGAAGTACAAATCATAATGTGG

CAGGAGACTGTTTTTTCCTTTTGTAATTCCAGGAATTGTATG ACCTTTGTTTGCCCACATCTAAGTTTCTACACGATGTCCTCTGTATGA
Translation
 MYGEKKSHLYLWMEHYGYDM MPANIYKMYSQPSRKTDDA ANKKVSVSASRTIKLNGSTG GYDTNEQITLITNGSS SLSYPDEIKSASYADPISTK

 KAYTNDSSVYDPGGASSS STTLYELNSLSEVSKEI IITQGESALLRDKEATSEL LKIPSTLQTQTSMSTNTL LSLSDLSSDYQEEQMNKC CKLN

QMSKLYDDDERTDIQKSYW WNVVKKFVRILVSSVAFR RIFGIFLVILDVFLVVVDLNVSEKKIYIPLDYRSISLAIALFFLVDVLLRVSVEG GRRRY

FSDVLNTLDAVVIGVTVVVAVIYALYDKHFLRDIPR RLAVLLRPLRLLILIRILQLAHQKRQLERLTRKL VSGNKRRYKKDGFDLDLTYVTE ERIIA

MSFPSSGRESFYRNPIK - UNI33988 - EVVRFLDTKHPNHYQVYNLCS SERAYDPKHFHYRVRRIMIDDHNVPTLE EEMLLFSKEVNNWMAQDP

ENVVAIHCKGGKG GRTGTMVCACLIASEIVLNAK ESLYFFGERRTDKSNSSKFQGIETPSQ NRYVKYFEKLKINYQLTLPPKKVLVIKRLVVYSIHG

 GVGKGDGSDLEVQIIMWQETVFSFCNSRNCM TFVCPHLSFYTMSSV
Transcript ENSMUST00000077194
Sequence
CGACCCTGGACATGGGAACTTTTAGATCAGCATATGTGGGACTACCCTTGTTTCTGGCTATGAACTGACTGATTTCGTTGACTTACCAAGCTTAATTTGG

GGGAAAATTAAAAAGAAAAGAGAATGAAAAAGAGGAAAAGCTGTTATTCTGAAGGGCAGCCGGAGAAAAGACTGGCAGCAGGAACTGGAGTGGACTCAGC

TCCCCCTTCGGGTCGAGGGGTAGCTAAGCTGTAAGACTCTAACTTGTGGGTCCCTCTGTCCGGCCCTGCTGCAGGGTCTTACTGGGGCTTTAGCGACTTC

TGAGCCCAAGCAGCCCAGAAAAAAAAAGCAGTGCCTTCAG ATTAATTGTAAGTTAAGTTGAATCACAAGACAATACCATGTATGGAGAAAAGAAGAGCC

ATTTGTATCTCTGGATGGAACACTATGGGTATGACAT GCCTGCAAATATTTACAAGATGTATTCTCAGCCCTCCAGAAAAACGGATGATGC AAATAAA

AAGGTGTCAGTGAGTGCTTCAAGGACCATTAAACTAAATGGCAGCACTGG CTACGACACAAATGAACAGATAACACTAATCACTAACGGGAGCAG TTT

GTCATATCCAGATGAAATAAAATCAGCAAGTTATGCGGACCCCATCAGTACAAA AGCATATACAAATGATTCGTCAGTATACGACCCTGGGGGAGCTTC

GAGCAG CACAACCCTGTATGAACTGAATTCCTTGAGTGAAGTATCGAAAGAAAT CATTACCCAGGGAGAATCTGCTTTACTACGTGATAAAGAAGCTA

CCAGCGAACT CAAAATCCCAAGTACACTGCAAACGCAGACGTCCATGTCCACCAACACTCT CTCCTTATCTGATTTATCATCAGATTACCAGGAAGAG

CAAATGAACAAATG CAAGTTAAACCAGATGTCCAAGTTGTACGACGATGATGAACGTACTGATATTCAAAAGTCATACTG GAATGTGGTTAAGAAATT

TGTGCGCATCCTTGTGTCCTCGGTTGCCTTCAG AATATTTGGAATTTTCCTGGTCATTCTGGATGTATTTCTTGTGGTTGTCGATCTAAATGTCTCTGA

AAAGAAAATTTATATTCCTTTGGACTATCGTTCCATTTCTTTAGCGATTGCTTTATTTTTCCTCGTGGATGTTCTTCTTAGAGTGTCTGTAGAAGG GAG

ACGGCGCTATTTCTCTGACGTACTGAACACCCTAGACGCTGTGGTCATCGGTGTGACTGTGGTTGTGGCTGTCATTTATGCACTTTATGACAAACACTTT

CTCAGAGATATCCCAAG ACTGGCAGTTTTACTGCGGCCTCTACGACTGCTCATTCTGATAAGGATTCTGCAACTGGCTCATCAAAAGAGACAACTCGAA

AGGCTGACCAGGAAGCTG GTATCGGGTAACAAGCGACGCTACAAGAAGGATGGCTTTGACCTAGACCTCACTTACGTCACTG AGCGTATTATTGCCAT

GTCATTTCCATCGTCTGGAAGGGAGTCCTTCTACAGAAATCCAATCAAG - UNI33988 - GAGGTTGTGCGGTTCCTGGATACCAAGCACCCAAACC

ACTATCAAGTCTACAATCTATGCA GTGAGAGAGCTTATGACCCTAAGCACTTCCACTACAGGGTCCGCAGAATCATGATTGATGATCATAATGTCCCCA

CTCTTGA GGAAATGTTGTTGTTCTCCAAGGAAGTAAATAATTGGATGGCTCAAGATCCTGAAAATGTTGTCGCGATTCACTGTAAGGGAGGAAAAG GA

AGAACTGGAACCATGGTGTGTGCCTGCCTCATTGCCAGTGAAATAGTTTTAAATGCAAAG GAAAGTCTGTACTTTTTTGGAGAGCGGCGGACAGATAAA

AGCAACAGCTCGAAGTTCCAAGGAATAGAGACCCCTTCTCAG AATAGATATGTGAAATATTTTGAAAAACTGAAAATTAACTACCAACTAACTCTCCCT

CCCAAAAAAGTACTCGTGATAAAAAGATTGGTCGTTTATTCCATTCATG GCGTTGGAAAAGGCGACGGGAGTGACCTGGAAGTACAAATCATAATGTGG

CAGGAGACTGTTTTTTCCTTTTGTAATTCCAGGAATTGTATG ATATTTCATGACCCTGAAACAGACAGAGCAATAATCAATGTGTTCCATTGCCCGGCT

CTATACGATGATGTGAAAGTGAAATTTCTCTCTCCG AATCTTCCTAAATACTATGATGACTGCCCCTTTTTCTTTTGGTTTCATACATCTTTTATTAAA

AATAACAG GCTTTATCTACCAAGAAACGAATTGGATAATACCCATAAACCAAAAACATGGAAAATTTATGGTGAAAAGTTTGCAGTAGAGGTGGATTTT

GGTGAGAACTAGCTGTTGAGTAAGTGCCGCTCCCCTTCTTGGATAGAATCATGTTCTTCCAGATCCATGCTACATAGTTATGTCTTCTAACCAATGTTTT

TGATGGTATGTCTGTATTTTATATATATGTGTGTGTATATGTATGTACATATGTTTCTGGGAAGTATATTAAATGTATACAGGAAAATT
Translation
 MYGEKKSHLYLWMEHYGYDM MPANIYKMYSQPSRKTDDA ANKKVSVSASRTIKLNGSTG GYDTNEQITLITNGSS SLSYPDEIKSASYADPISTK

 KAYTNDSSVYDPGGASSS STTLYELNSLSEVSKEI IITQGESALLRDKEATSEL LKIPSTLQTQTSMSTNTL LSLSDLSSDYQEEQMNKC CKLN

QMSKLYDDDERTDIQKSYW WNVVKKFVRILVSSVAFR RIFGIFLVILDVFLVVVDLNVSEKKIYIPLDYRSISLAIALFFLVDVLLRVSVEG GRRRY

FSDVLNTLDAVVIGVTVVVAVIYALYDKHFLRDIPR RLAVLLRPLRLLILIRILQLAHQKRQLERLTRKL VSGNKRRYKKDGFDLDLTYVTE ERIIA

MSFPSSGRESFYRNPIK - UNI33988 - EVVRFLDTKHPNHYQVYNLCS SERAYDPKHFHYRVRRIMIDDHNVPTLE EEMLLFSKEVNNWMAQDP

ENVVAIHCKGGKG GRTGTMVCACLIASEIVLNAK ESLYFFGERRTDKSNSSKFQGIETPSQ NRYVKYFEKLKINYQLTLPPKKVLVIKRLVVYSIHG

 GVGKGDGSDLEVQIIMWQETVFSFCNSRNCM IFHDPETDRAIINVFHCPALYDDVKVKFLSP NLPKYYDDCPFFFWFHTSFIKNNR RLYLPRNELD

NTHKPKTWKIYGEKFAVEVDFGEN

For any suggestions or comments, please send an email to unitrap@crg.es