Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000031488 (Rab11fip1)
Chromosomal location
Chr 8: 28249245 - 28285120 (-)
Description
RAB11 family interacting protein 1 (class I) Gene [Source:MGI Symbol;Acc:MGI:1923017]
RefSeq_dna
NM_001080813 
RefSeq_peptide
NP_001074282.1 
UniGene
Mm.205335 
MGI
MGI:1923017 
Uniprot/SWISSPROT
Q9D620 
Uniprot/SPTREMBL
Q05A58 Q6KAN5 Q8K028 
Human Ortholog
ENSG00000156675 (RAB11FIP1)
Omim not available
UniTrap UNI13318
Vector Insertion
Chr 8: 28267142 - 28284680
Public Clones CMHD-GT_340A8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30018
Vector Insertion
Chr 8: 28262068 - 28265408
Public Clones D153B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28353
Vector Insertion
Chr 8: 28261276 - 28262068
Public Clones not available
Private Clones OST33118 (lexicon)
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29135
Vector Insertion
Chr 8: 28253867 - 28261166
Public Clones (sanger) IST12342B4 (tigm)
Private Clones OST7520 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000033878
Sequence
GCGGTCCAGACCGAGGACAGCGGCTACCTTCTGGCTTCCTAGCCTGGTGCCGCGTCTGCCACCATGTCCCTGGCGGCCTCAGCGGGCCGGGGCCCGGGGA

CCATGTGGTCCCCTACCCACGTGCAGGTGACGGTGCTACAGGCGCGGGGCTTGCGGGCCAAGGGACCCGGGGGCACGAGCGACGCGTACGCGGTGATCCA

GGTGGGCAAGGAGAAGTACGCCACGTCGGTGTCGGAGCGCAGCCTGGGCGCGCCCGTGTGGCGCGAGGAAGCCACCTTCGAGCTGCCTCCGCTGCTGTCC

TCCGGGGCCGCGCCGGCCGCCGCCGCCACCCTGCAGCTCACCGTCCTGCACCGCGCGTTGCTCGGTCTCGATAAGTTCCTGGGCCGCGCCGAGGTGGACC

TGCGGGAGCTGCACCGGGACCAGGGCCGCAGGAAGAAGCA - UNI13318 - ATGGTACACCCTGAAGTCCAAACCCGGGAAGAAGGACAAAGAGCGC

GGGGAAATCGAGGTCGACATCCAGTTTATGAGGAATAACATGACGGCCAGCATGTTTGACCTCTCCATGAAAGACAAGTCCCGGAATCCATTTGGAAAAC

TGAAGGACAAGATCAAAGGGAAGAATAAGGACAGCGCCTCGGATACCGCCTCGGCCATCGTCCCCAGCGTGACACCCTCAGTCGACAGTGACGATGAGTC

CTTCTCGAAAGACAAGAAAAAGAAGTCAAAGATCAAGACTTTGTTTTCCAAGTCGAGTCTGCAGAAGACGCCCCTCTCCCAGTCCATGTCTGTCCTGCCC

ACTTCCAAGTCAGACAAAGTTCTGTTGCGGGCCGGAGACTTCCAGTCCCAGTGGGACGATGACGCCCATGAGGATGAGTCCTCCTCCGCCTCGGATG - 

UNI30018 - TCATGTCTCACAAGCGAACATCCAGTACAGACCAACAACCGAACCAGTCCAACTTCAGCCTTCCCAAGAAAGAGGGGCTTTCCTTCCTT

GGGGGCCTCCGGTCCAAGAATGACTCTCTTTCCCGCTCTACCGTCTGTATCAACGGGAACCACGTTTACATGGAGCAGCCGGAGGCCAGGAGTGAGATCA

GAGAGAGCAGCCCTTCTAATTCCCCATCCCCGCAGGGCTTCAGGAGGAAGCATTTGTTCTCGTCCACTGAAAACCTGGCTGCCCGCTCTCCCAAGGAACC

AGGGGAAGGAGGCGGCACATCTTCTGACAGGCGACTGTCCGACTCTTCCACCAAGGATTCCATGAAGTCCATGTCTTTGCCATCCTACCGGCCTCTGACC

AGTGGGGACAATAGAGAGAGCATGTCTCCAGCAAACGTGGAGGCTGCCAGAGAGACAAAAGACAGCAAGAAACAGGAGAGCAAGAAGTCCTCTTTGCTTT

CTCTGGTGACGGGAAAGAGGGATGCGGCGGCTAAAGGCAGTGAAAGCGAACCTCTTCCCACTGTCTCAGAGAAAGAGAAGGAGAGGAAAGGCGCGCTCGT

GGAAGCCCAGCTGCGGGAGGAAGACCTCATGAGAAGGCCTGAGAAAGATGCTCTACCTGTTGCCTCCCAGTGGGGCAGCTCCTTGAACCCCTTTGAGGAC

GTGCAGATCTCAGACCCGGGAGCCACCACGGAGTCCAGGTCGGAACCGAAACCACCAGTTCCTGCGGCCAGGGTTCCCCAGACCAAGGCTGTGAAGCCGA

G - UNI28353 - - UNI30018 - GCCTCACCCTGTGAAGCCCATGAACACAACAGCCACCAAGATTGCAAACTCTAGTTTGGGAACCGCCACCAT

CATCACTGAGAACCTGATCAGCGAGGCCCTCATGAAG - UNI29135 - AAATACCAGCCCTCGGATCCCGCCTTTGCCTACGCGCAGCTGACCCACG

ATGAGCTGATCCAGCTAGTCCTCAAACAGAAGGAGACCATCAGCAAGAAGGAGTTTCAGGTGCGGGAGCTGGAGGACTACATCGACAACCTGCTAGTCAG

AGTCATGGAGGAGACCCCCAACATCCTCCGAGTGCCGGCGCAGATGGGCAAGAAGGCCGGAAAGATGTAAACTGCGGGAAGGAGGCGTGGTCTGAAGGAG

GCGTGGTCTCCCTAGTAACTAGCACACCGGTTCCGAAGGCCTGCTGTGTGCATCATCTCTCAAGAGTTAATTCTCCTAGCTGAAAACCAGATTAATGATT

ACAACGAATCTTTTACTATACATCTCCCAGCGTTTTGTTTTTCAATGCCACTGTGCCTTTGACTACATTGTAAATATCAGATTTGATCCGATGTGTTTTA

ACGCCAGGGTTGTTGCCCTTTGATGCTGAGATCTTCCGGTATGGATCCTCCGTGAAGGCAGGCTCAGGGTGAGATGAGAAAGGGACTTTGGGATGTGTGC

TGTTTCACCCGCTCTCTTGGCCTTTGAGCACCTCGGTTGAGGCACAAGCTCAATTTTTAATTCGGGTAAACCCGAGGACTCAAGGGTTGTTTTGGTGAGG

GTTGGTTTGGGAGGCGTTGTTCTGTTTTCAGGGTGGGGTGTTATGTAGCCCCGGGCTGGGGCTGCTCTTGAACTCACTGTGTACTGAGATTGGCCTTAGA

TTTCTGACCTTTCTGCCCCCCACTGCCAAGTGCTAGGATTACAGCCGTGTTTGATGCCTTCTGGTCGGAGCACGGTTGTTTACATAAAACCTCTGAGCAT

GCTTCTTAGATTTTTGAATATGCCTTTTACAATTGGCAGTACCCTCTGGCCTTAAAAATATGTTCTCCATGGATTGGGGGATATAGCTCAGTGGGTAAGG

TGCTTGCACTACAAACCTGATGGTCTCCGTTTGGATTCTTAGCATCTATGCTAAAGCCAGGAAGAGTGGCATGTGCCTGGGTGGGGGCTGGGCTGGGGGA

GGGCAGAGCCAGGCAGATCTCAGGGGCTCACTGGAAACTCCAGGTTCAGTGAGGGACAGTCTTAAACAATAAAATGAAAAGCTACCATAGACCTCTGCCC

TTCATGTGGTCACACACACACACACACACTGCTCTTTAGATCTATAGGGCCATTTCCTGGAGACATGAAAGAACTAAAGAGTCACTTTTCAGGCTGGAGT

GATAGTCTAGTGGTTAAGAGCACTCACTGGCTGAACAGTGGACCAGGTCCAGAGGACTTGGGTTCAATTCCCAGCAACCACATGGTAGCTCACAACTGTC

TGTAATTTCTGTTCAAGGGAATCTGACCGTGTCACCCGGACATCCATGCAGACAAAATATCAATACACATAACATTAAATTTAAAAGGAAACAGAGAGTC

GGTCTCTCCTCAGGGTTCGGGGTTCCTGTTGCCCCGCTGGCCTTTCCTAGGTGGGGAGGGGACTGAGTTCCTCTACAGCATCTCTGTGAGGTGGAGGATG

ATTTTAGGACCGGACCTTTGGCCGTTTCCTGCCATCGGCTTGTCTCAATGGCGTTTCCTGGAAGGGAGTAGACAGTCCACTGATTTCTCAAGATGAAGGA

GGCTCAGGCAGGGGCTGGGTAAGTGCTCAGGGGTAGAGCGCCCCAGCCACACGTCAGCGGTAAGGAACAGTTGTGAAGAGCTACAGGATGGCATCTGCTT

CTTTGCTGCTACCTCCTGATTTGGGGAGTTTTGTTGCTGCTATTTTGAGACAGATCTCACTGGCTTTAAGCTTTTCACACATACACACACCCCCACCCCC

ACCCCCGCCTCAGTTTTTCAAATTTCCAAATACTGGAATTACAGGTATGTGCCACCATTCCTGGTAGATCAATGTATTTTTTTTTTTATAAAATGTACAC

ACACACACATATATATATATACACATATATGCACACCTTAATATATATATATATATACATATATACACACATCTTAAAACACACACATATGTATATATAC

ATACACATATAGATGCACACCTTAATATACACACACACACACACACACACACACACACACACACACGGCCGCTTTTTCACTAGTAGAGGGAATTCCATTG

CTGGTCACCTCATTCTGGAATTAAAATGTTTCATGATTTTTTTTTTTCTTCCTGGTAGTAATAAAAAATCTCACTAAATCTTAACACCTCTGCTCAGCGA

GTCATAGGCCAATGCCGTGGATAGGGTTGCCGTGGATAGGGTGGGGTAGCGGTGGTTCTCAATGAAGAATCTGTGTGTTCTTATCACCCGGAAGGTGAGG

AACGCTGGTTATACTGCAGCACTTTAATCTGAAGGGCAAGACTGTAACTTGATTTACCTAACAAGCTGTTGATGATCCACACGTATTTTTATTTAATCTC

TCTTACAGTACTAGGGACCACTGTAAATTTCTTGAGATGATTTGTATTTTTTTTTTTTTTTAGTGTCATGAAATTCATTAATATGCCTATAAAGAAACTG

TATCCACTTGATCTCTGAAAATGTACATGTATATTTCTGTTCTGCATCCTGGGGTTTTGGTTTGATTTTTTGTTTTGTTTTTTTTGTTTTTAACTTGATA

TAAGTGCATTTTTACTGTGATAACCTAAGTGCACTGGAGCACTGCTCAGAAGAGGCAGCCTGGGGAGCTGCCTTGTGTATGAAGAGTCTGGAGGTCTCTA

CTGCTACTCAGACCTTTGGTATGTAACCGAGTCAGCTCTAGCGAGGACCGTCTAGGTGAAGTGAATTCCTGTGCTCTGAAATGCCACTTGGGGACTCTGG

AGAATGAAGGACAGTTTACTTCGGGGGCTTTGCTGGTTTCTGCAGTGCTGGGAAACACTGCCTTTCTGACGTTGCTGTACCTCACAAGGTAATAGAGGCC

CTGCCTACTTATAATAACTGTTCCTGACTATTTGGTCGGGCACTAAGGAGTGATACCAACCAAGGGAAGCCGAACCTGCATTGAGCCACTGGCAGAGGCT

GGTGACAGGGAGAGCCCTGGAGCTACTGAGGCTGACCTCTGCCTTGTGCTTGTAGCTTCCACTGATGCCAACTTGAGGTGCCCTGGAGGGGCCTACACTC

TGGAGAAAGAAGAGAAGGAAGGGAAGAAAGAAGAAAGAAAGAGCCCTTTCCTTGCCCATGCCTGGCTACCTCCAAGAAAGCCCAGCCAGAGATTTGGGTG

GGGTATGAAGGCGTTGGATTAAATACCAGCATACTCCATTTTAGGACAGCATCCTAAAAACCAGCCAGCCCTTGGCCTAATCGTTTCATATCATCTTATC

TTTGGCTTCGGCACTTGGCCTGGCTTCCCTGTTTTATTCCACCATATTACCTTTACTTGGGCCACAGAAAGAAGGAGCAAGCAACCCTGCCCTGTGCCAT

GCTCCACTGCTGTCCAGCAAGAGAGGCTGGTCCATGACGCTTCACCGTGCACTGTATCGAGGCTAGAGTTCTCCATCCCTAGGTTCTTCTCCCAGTCAAC

CACACCGCCCCCTTTGGGTGTCTTGTGCTTGCTAATTCCATGCTCTGTTGCTGAGTTACACTCTTAGCTGGACCCTCCCCCGAGTTGTGTTTCTGTCTTT

GTTTTTTGAGACAGTTTCTCATGTGAGCCAGGTTAATCTTGATTTTATGGCTATTAATGACCTTGAACTCATTATCCTCCTGCCTCTGCCTTCTGAGTGC

TGGGAATATCAGAGTGTGCTATCATTCACAGCTTTTAATTTTTTTTTCTGAGGGTGGGGGTGGGTACTAATTGAGGATCCTTCAAGACTGAAAATCTATT

GTCTTAGATAAGAAGCATGAACCCGGGCTGGAGAGATGGCTCAGTGGTTAAGAGCTCTGACTGGGGCTGGAGAGATGGCTTAGCAGTTAAGAGCACTGTC

TGATGTTCCGAAGGTCCTGAGTTCAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAATGAGATCTGATACCCTCTTCTGGTGTATCTGAAGAC

AGCTTCAGTGTGCTTATTTATAATAATAAATAAAATCTTTAAAGAGAGAGAGAGAGCTGACTGCTCGTCCAGAGGTCTAGAGTTCAATTCCTGGCAACCA

CATGGGGACTCACAACCATCTGTAATGGAATGCAGTGCCCTCTTCTGGTGTGTCTAAAGAGGGCTATATGTACTTACATATATTAAATAAAAAAGCCTTT

TTTTTTGAGAGAGAGAGAGGTGAACCCATGCCAACCCCAACTCTGACTTTTCCTACCTACTTTGATAAGCTACTAAATTGACTTTCACCTCCCTCTAACG

GAAGGTTCACCTAATACTGTGTGTTTGCCTTACATGTGCAAAGCACTAGGCTTGATCACACACTCCAGCCCCAGGACTGTAAACTGAGCAATGTGACGGA

CGATCTGTAATCCCAGCCAGCACCAGGGAGGTGAAATCGGGTGACCAACAGTTCAATTGCATTCTCAGCAGCATAGGGAGGTTTAAGTCAGACGGCGATA

CACAAGCCCTTGTCTCAAAACAAACAAAACCCTAAGACTTCCTAACAATAAATACAATCACACTACCTTTCAA
Translation
MSLAASAGRGPGTMWSPTHVQVTVLQARGLRAKGPGGTSDAYAVIQVGKEKYATSVSERSLGAPVWREEATFELPPLLSSGAAPAAAATLQLTVLHRALL

GLDKFLGRAEVDLRELHRDQGRRKKQ - UNI13318 - QWYTLKSKPGKKDKERGEIEVDIQFMRNNMTASMFDLSMKDKSRNPFGKLKDKIKGKNKD

SASDTASAIVPSVTPSVDSDDESFSKDKKKKSKIKTLFSKSSLQKTPLSQSMSVLPTSKSDKVLLRAGDFQSQWDDDAHEDESSSASDV - UNI30018

 - VMSHKRTSSTDQQPNQSNFSLPKKEGLSFLGGLRSKNDSLSRSTVCINGNHVYMEQPEARSEIRESSPSNSPSPQGFRRKHLFSSTENLAARSPKEP

GEGGGTSSDRRLSDSSTKDSMKSMSLPSYRPLTSGDNRESMSPANVEAARETKDSKKQESKKSSLLSLVTGKRDAAAKGSESEPLPTVSEKEKERKGALV

EAQLREEDLMRRPEKDALPVASQWGSSLNPFEDVQISDPGATTESRSEPKPPVPAARVPQTKAVKPR - UNI28353 - - UNI30018 - RPHPVK

PMNTTATKIANSSLGTATIITENLISEALMK - UNI29135 - KYQPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEET

PNILRVPAQMGKKAGKM
Transcript ENSMUST00000054212
Sequence
GCGGTCCAGACCGAGGACAGCGGCTACCTTCTGGCTTCCTAGCCTGGTGCCGCGTCTGCCACCATGTCCCTGGCGGCCTCAGCGGGCCGGGGCCCGGGGA

CCATGTGGTCCCCTACCCACGTGCAGGTGACGGTGCTACAGGCGCGGGGCTTGCGGGCCAAGGGACCCGGGGGCACGAGCGACGCGTACGCGGTGATCCA

GGTGGGCAAGGAGAAGTACGCCACGTCGGTGTCGGAGCGCAGCCTGGGCGCGCCCGTGTGGCGCGAGGAAGCCACCTTCGAGCTGCCTCCGCTGCTGTCC

TCCGGGGCCGCGCCGGCCGCCGCCGCCACCCTGCAGCTCACCGTCCTGCACCGCGCGTTGCTCGGTCTCGATAAGTTCCTGGGCCGCGCCGAGGTGGACC

TGCGGGAGCTGCACCGGGACCAGGGCCGCAGGAAGAAGCA - UNI13318 - ATGGTACACCCTGAAGTCCAAACCCGGGAAGAAGGACAAAGAGCGC

GGGGAAATCGAGGTCGACATCCAGTTTATGAGGAATAACATGACGGCCAGCATGTTTGACCTCTCCATGAAAGACAAGTCCCGGAATCCATTTGGAAAAC

TGAAGGACAAGATCAAAGGGAAGAATAAGGACAGCGCCTCGGATACCGCCTCGGCCATCGTCCCCAGCGTGACACCCTCAGTCGACAGTGACGATGAGTC

CTTCTCGAAAGACAAGAAAAAGAAGTCAAAGATCAAGACTTTGTTTTCCAAGTCGAGTCTGCAGAAGACGCCCCTCTCCCAGTCCATGTCTGTCCTGCCC

ACTTCCAAGTCAGACAAAGTTCTGTTGCGGGCCGGAGACTTCCAGTCCCAGTGGGACGATGACGCCCATGAGGATGAGTCCTCCTCCGCCTCGGATG - 

UNI30018 - TCATGTCTCACAAGCGAACATCCAGTACAGACCAACAACCGAACCAGTCCAACTTCAGCCTTCCCAAGAAAGAGGGGCTTTCCTTCCTT

GGGGGCCTCCGGTCCAAGAATGACTCTCTTTCCCGCTCTACCGTCTGTATCAACGGGAACCACGTTTACATGGAGCAGCCGGAGGCCAGGAGTGAGATCA

GAGAGAGCAGCCCTTCTAATTCCCCATCCCCGCAGGGCTTCAGGAGGAAGCATTTGTTCTCGTCCACTGAAAACCTGGCTGCCCGCTCTCCCAAGGAACC

AGGGGAAGGAGGCGGCACATCTTCTGACAGGCGACTGTCCGACTCTTCCACCAAGGATTCCATGAAGTCCATGTCTTTGCCATCCTACCGGCCTCTGACC

AGTGGGGACAATAGAGAGAGCATGTCTCCAGCAAACGTGGAGGCTGCCAGAGAGACAAAAGACAGCAAGAAACAGGAGAGCAAGAAGTCCTCTTTGCTTT

CTCTGGTGACGGGAAAGAGGGATGCGGCGGCTAAAGGCAGTGAAAGCGAACCTCTTCCCACTGTCTCAGAGAAAGAGAAGGAGAGGAAAGGCGCGCTCGT

GGAAGCCCAGCTGCGGGAGGAAGACCTCATGAGAAGGCCTGAGAAAGATGCTCTACCTGTTGCCTCCCAGTGGGGCAGCTCCTTGAACCCCTTTGAGGAC

GTGCAGATCTCAGACCCGGGAGCCACCACGGAGTCCAGGTCGGAACCGAAACCACCAGTTCCTGCGGCCAGGGTTCCCCAGACCAAGGCTGTGAAGCCGA

G - UNI30018 - ACTGGAAGTTTCTCCAGAGGCTCAGCCCAAAGCCAGGCTTCCCTCCCCCGACTCTGCTCTCTTTGCCCCCTTTCCCTCTGACTCT

ATTCAGCCTCCTGTCCTTTCCGACTTGAGATGTGACTCAGAGACACAGTTCTCTGAAAGTCCTTCTGCCTCCTCTTTCTTGTCCCCCTTAGCAGCTCCTA

TCTCCACATCCACTCCAGTCGAGCCCTGGCCCACAGGCCAGGGTGAGGCCGATGCTGAAAAACCTTCCTTGCTCCTCAGAGCAGTCCCTAGTTTAACACC

GGCTGCAAACACTGGTTCTTCTGCCTCGGGATCACCTTGTGAACAACTTCCTACACCTGTGCGGAAGGGGACGGAAGAGGCGTCAGGGGACACAAGGAAG

GAAGCTGGCAGTGATGAATCGGGAAAGACCCTCATGACAGAGTGTGTGTCTTCTGTGGATAATGTTCACGATGGCGGAATGACTACAGCAGGGGAAGAAG

CAGCGCCCCCTCTTCTAGAGGACGAGGCCTCCTCGTTTCACCGCATCGCACAGAAACACGAGGGGATGCATCAGAATGCCAGCGGAGGGCAGAAGAAGGG

CAAGAAGCGCGTGTCTTTTTCTGAACAGCTTTTTGTGGAAGAAGAAACAGAAGGACCCACTAGGCTTGAGGAGGAGGACAGAGGTCATGCCCAGCAGCTG

ACACAGGAAGGGCCTGTTGCTGGAAGCGTGCTCCGTGCAGGGTCTCCAGAGTCTCCCCACACAGAAGGCACAGGACAGGAACCTGTGACCGCAGAAGCTC

AGCCTAACATTTCTTCTGAAGGCAAGTGTTTCCCGGAAGGCCCCACAAGTGAAGCCAGCCCAGCAAGAGGTACCCAGCCTTTGATGGATGAGAAGGATGA

CCTCATGGCTCCCTGTCAGAGCAAAGCCAGCGATCATGAAGGCCTGCTCTCTAACCCCCTGAGTGACCTTCCGTCCGCCTCGGATGTGAAATCTCCCATC

ATAGCTGATCTGAGCTTGTCTCTCCCGTCCATTCCTGAAGTGGCATCGGATGATGAAAGAGTCGATGAGGTTGGAGATGGAGGAAAGGCAGAGAAGTTGG

TTGATCTAGAAGCAGGAGTTTCACCCTGGAACGTGTCACATTCCATCCTGGAGACGTCAGGAAGGTCTAGTGGCAGGGCAGGTGAATCAGTGCCCACAGA

GAATCAGTGTGACTTCAGGCCCCAGGTTCGCTCAAGTGAGAATGAAGAGCTACCAGGCCCTGGCACTGTCGAGGAAGAGAAGCTGATAGGAGGTGAGAAG

CCAGCTTCACCTCTGTGCGTATCCCAGGACTCTTCTGTGCCCAGCCCCTCAGTCGCTGAGACCTTTCCCGCCGCATACTCTTCCCCCAGTTCTCCACCTT

CCGACACTCACCACACCAGTGAAGCAGAATCGCAAAAACAAGCAACGGCAGACGTCTCCACTAGTAGAGCTGAGAATTTTGGCAAGAAGAAGCCACTTCT

ACAAGCCTGGGTTACACCCTCAGAGATACATCCAACCCCAGCTTTGCCAAGCGCAGGAGCTGGGGCAGCCAAGCACAG - UNI28353 - - UNI300

18 - GCCTCACCCTGTGAAGCCCATGAACACAACAGCCACCAAGATTGCAAACTCTAGTTTGGGAACCGCCACCATCATCACTGAGAACCTGATCAGCG

AGGCCCTCATGAAG - UNI29135 - AAATACCAGCCCTCGGATCCCGCCTTTGCCTACGCGCAGCTGACCCACGATGAGCTGATCCAGCTAGTCCTC

AAACAGAAGGAGACCATCAGCAAGAAGGAGTTTCAGGTGCGGGAGCTGGAGGACTACATCGACAACCTGCTAGTCAGAGTCATGGAGGAGACCCCCAACA

TCCTCCGAGTGCCGGCGCAGATGGGCAAGAAGGCCGGAAAGATGTAAACTGCGGGAAGGAGGCGTGGTCTGAAGGAGGCGTGGTCTCCCTAGTAACTAGC

ACACCGGTTCCGAAGGCCTGCTGTGTGCATCATCTCTCAAGAGTTAATTCTCCTAGCTGAAAACCAGATTAATGATTACAACGAATCTTTTACTATACAT

CTCCCAGCGTTTTGTTTTTCAATGCCACTGTGCCTTTGACTACATTGTAAATATCAGATTTGATCCGATGTGTTTTAACGCCAGGGTTGTTGCCCTTTGA

TGCTGAGATCTTCCGGTATGGATCCTCCGTGAAGGCAGGCTCAGGGTGAGATGAGAAAGGGACTTTGGGATGTGTGCTGTTTCACCCGCTCTCTTGGCCT

TTGAGCACCTCGGTTGAGGCACAAGCTCAATTTTTAATTCGGGTAAACCCGAGGACTCAAGGGTTGTTTTGGTGAGGGTTGGTTTGGGAGGCGTTGTTCT

GTTTTCAGGGTGGGGTGTTATGTAGCCCCGGGCTGGGGCTGCTCTTGAACTCACTGTGTACTGAGATTGGCCTTAGATTTCTGACCTTTCTGCCCCCCAC

TGCCAAGTGCTAGGATTACAGCCGTGTTTGATGCCTTCTGGTCGGAGCACGGTTGTTTACATAAAACCTCTGAGCATGCTTCTTAGATTTTTGAATATGC

CTTTTACAATTGGCAGTACCCTCTGGCCTTAAAAATATGTTCTCCATGGATTGGGGGATATAGCTCAGTGGGTAAGGTGCTTGCACTACAAACCTGATGG

TCTCCGTTTGGATTCTTAGCATCTATGCTAAAGCCAGGAAGAGTGGCATGTGCCTGGGTGGGGGCTGGGCTGGGGGAGGGCAGAGCCAGGCAGATCTCAG

GGGCTCACTGGAAACTCCAGGTTCAGTGAGGGACAGTCTTAAACAATAAAATGAAAAGCTACCATAGACCTCTGCCCTTCATGTGGTCACACACACACAC

ACACACTGCTCTTTAGATCTATAGGGCCATTTCCTGGAGACATGAAAGAACTAAAGAGTCACTTTTCAGGCTGGAGTGATAGTCTAGTGGTTAAGAGCAC

TCACTGGCTGAACAGTGGACCAGGTCCAGAGGACTTGGGTTCAATTCCCAGCAACCACATGGTAGCTCACAACTGTCTGTAATTTCTGTTCAAGGGAATC

TGACCGTGTCACCCGGACATCCATGCAGACAAAATATCAATACACATAACATTAAATTTAAAAGGAAACAGAGAGTCGGTCTCTCCTCAGGGTTCGGGGT

TCCTGTTGCCCCGCTGGCCTTTCCTAGGTGGGGAGGGGACTGAGTTCCTCTACAGCATCTCTGTGAGGTGGAGGATGATTTTAGGACCGGACCTTTGGCC

GTTTCCTGCCATCGGCTTGTCTCAATGGCGTTTCCTGGAAGGGAGTAGACAGTCCACTGATTTCTCAAGATGAAGGAGGCTCAGGCAGGGGCTGGGTAAG

TGCTCAGGGGTAGAGCGCCCCAGCCACACGTCAGCGGTAAGGAACAGTTGTGAAGAGCTACAGGATGGCATCTGCTTCTTTGCTGCTACCTCCTGATTTG

GGGAGTTTTGTTGCTGCTATTTTGAGACAGATCTCACTGGCTTTAAGCTTTTCACACATACACACACCCCCACCCCCACCCCCGCCTCAGTTTTTCAAAT

TTCCAAATACTGGAATTACAGGTATGTGCCACCATTCCTGGTAGATCAATGTATTTTTTTTTTTATAAAATGTACACACACACACATATATATATATACA

CATATATGCACACCTTAATATATATATATATATACATATATACACACATCTTAAAACACACACATATGTATATATACATACACATATAGATGCACACCTT

AATATACACACACACACACACACACACACACACACACACACACGGCCGCTTTTTCACTAGTAGAGGGAATTCCATTGCTGGTCACCTCATTCTGGAATTA

AAATGTTTCATGATTTTTTTTTTTCTTCCTGGTAGTAATAAAAAATCTCACTAAATCTTAACACCTCTGCTCAGCGAGTCATAGGCCAATGCCGTGGATA

GGGTTGCCGTGGATAGGGTGGGGTAGCGGTGGTTCTCAATGAAGAATCTGTGTGTTCTTATCACCCGGAAGGTGAGGAACGCTGGTTATACTGCAGCACT

TTAATCTGAAGGGCAAGACTGTAACTTGATTTACCTAACAAGCTGTTGATGATCCACACGTATTTTTATTTAATCTCTCTTACAGTACTAGGGACCACTG

TAAATTTCTTGAGATGATTTGTATTTTTTTTTTTTTTTAGTGTCATGAAATTCATTAATATGCCTATAAAGAAACTGTATCCACTTGATCTCTGAAAATG

TACATGTATATTTCTGTTCTGCATCCTGGGGTTTTGGTTTGATTTTTTGTTTTGTTTTTTTTGTTTTTAACTTGATATAAGTGCATTTTTACTGTGATAA

CCTAAGTGCACTGGAGCACTGCTCAGAAGAGGCAGCCTGGGGAGCTGCCTTGTGTATGAAGAGTCTGGAGGTCTCTACTGCTACTCAGACCTTTGGTATG

TAACCGAGTCAGCTCTAGCGAGGACCGTCTAGGTGAAGTGAATTCCTGTGCTCTGAAATGCCACTTGGGGACTCTGGAGAATGAAGGACAGTTTACTTCG

GGGGCTTTGCTGGTTTCTGCAGTGCTGGGAAACACTGCCTTTCTGACGTTGCTGTACCTCACAAGGTAATAGAGGCCCTGCCTACTTATAATAACTGTTC

CTGACTATTTGGTCGGGCACTAAGGAGTGATACCAACCAAGGGAAGCCGAACCTGCATTGAGCCACTGGCAGAGGCTGGTGACAGGGAGAGCCCTGGAGC

TACTGAGGCTGACCTCTGCCTTGTGCTTGTAGCTTCCACTGATGCCAACTTGAGGTGCCCTGGAGGGGCCTACACTCTGGAGAAAGAAGAGAAGGAAGGG

AAGAAAGAAGAAAGAAAGAGCCCTTTCCTTGCCCATGCCTGGCTACCTCCAAGAAAGCCCAGCCAGAGATTTGGGTGGGGTATGAAGGCGTTGGATTAAA

TACCAGCATACTCCATTTTAGGACAGCATCCTAAAAACCAGCCAGCCCTTGGCCTAATCGTTTCATATCATCTTATCTTTGGCTTCGGCACTTGGCCTGG

CTTCCCTGTTTTATTCCACCATATTACCTTTACTTGGGCCACAGAAAGAAGGAGCAAGCAACCCTGCCCTGTGCCATGCTCCACTGCTGTCCAGCAAGAG

AGGCTGGTCCATGACGCTTCACCGTGCACTGTATCGAGGCTAGAGTTCTCCATCCCTAGGTTCTTCTCCCAGTCAACCACACCGCCCCCTTTGGGTGTCT

TGTGCTTGCTAATTCCATGCTCTGTTGCTGAGTTACACTCTTAGCTGGACCCTCCCCCGAGTTGTGTTTCTGTCTTTGTTTTTTGAGACAGTTTCTCATG

TGAGCCAGGTTAATCTTGATTTTATGGCTATTAATGACCTTGAACTCATTATCCTCCTGCCTCTGCCTTCTGAGTGCTGGGAATATCAGAGTGTGCTATC

ATTCACAGCTTTTAATTTTTTTTTCTGAGGGTGGGGGTGGGTACTAATTGAGGATCCTTCAAGACTGAAAATCTATTGTCTTAGATAAGAAGCATGAACC

CGGGCTGGAGAGATGGCTCAGTGGTTAAGAGCTCTGACTGGGGCTGGAGAGATGGCTTAGCAGTTAAGAGCACTGTCTGATGTTCCGAAGGTCCTGAGTT

CAAATCCCAGCAACCACATGGTGGCTCACAACCATCTGTAATGAGATCTGATACCCTCTTCTGGTGTATCTGAAGACAGCTTCAGTGTGCTTATTTATAA

TAATAAATAAAATCTTTAAAGAGAGAGAGAGAGCTGACTGCTCGTCCAGAGGTCTAGAGTTCAATTCCTGGCAACCACATGGGGACTCACAACCATCTGT

AATGGAATGCAGTGCCCTCTTCTGGTGTGTCTAAAGAGGGCTATATGTACTTACATATATTAAATAAAAAAGCCTTTTTTTTTGAGAGAGAGAGAGGTGA

ACCCATGCCAACCCCAACTCTGACTTTTCCTACCTACTTTGATAAGCTACTAAATTGACTTTCACCTCCCTCTAACGGAAGGTTCACCTAATACTGTGTG

TTTGCCTTACATGTGCAAAGCACTAGGCTTGATCACACACTCCAGCCCCAGGACTGTAAACTGAGCAATGTGACGGACGATCTGTAATCCCAGCCAGCAC

CAGGGAGGTGAAATCGGGTGACCAACAGTTCAATTGCATTCTCAGCAGCATAGGGAGGTTTAAGTCAGACGGCGATACACAAGCCCTTGTCTCAAAACAA

ACAAAACCCTAAGACTTCCTAACAATAAATACAATCACACTACCTTTCAA
Translation
MSLAASAGRGPGTMWSPTHVQVTVLQARGLRAKGPGGTSDAYAVIQVGKEKYATSVSERSLGAPVWREEATFELPPLLSSGAAPAAAATLQLTVLHRALL

GLDKFLGRAEVDLRELHRDQGRRKKQ - UNI13318 - QWYTLKSKPGKKDKERGEIEVDIQFMRNNMTASMFDLSMKDKSRNPFGKLKDKIKGKNKD

SASDTASAIVPSVTPSVDSDDESFSKDKKKKSKIKTLFSKSSLQKTPLSQSMSVLPTSKSDKVLLRAGDFQSQWDDDAHEDESSSASDV - UNI30018

 - VMSHKRTSSTDQQPNQSNFSLPKKEGLSFLGGLRSKNDSLSRSTVCINGNHVYMEQPEARSEIRESSPSNSPSPQGFRRKHLFSSTENLAARSPKEP

GEGGGTSSDRRLSDSSTKDSMKSMSLPSYRPLTSGDNRESMSPANVEAARETKDSKKQESKKSSLLSLVTGKRDAAAKGSESEPLPTVSEKEKERKGALV

EAQLREEDLMRRPEKDALPVASQWGSSLNPFEDVQISDPGATTESRSEPKPPVPAARVPQTKAVKPR - UNI30018 - RLEVSPEAQPKARLPSPDS

ALFAPFPSDSIQPPVLSDLRCDSETQFSESPSASSFLSPLAAPISTSTPVEPWPTGQGEADAEKPSLLLRAVPSLTPAANTGSSASGSPCEQLPTPVRKG

TEEASGDTRKEAGSDESGKTLMTECVSSVDNVHDGGMTTAGEEAAPPLLEDEASSFHRIAQKHEGMHQNASGGQKKGKKRVSFSEQLFVEEETEGPTRLE

EEDRGHAQQLTQEGPVAGSVLRAGSPESPHTEGTGQEPVTAEAQPNISSEGKCFPEGPTSEASPARGTQPLMDEKDDLMAPCQSKASDHEGLLSNPLSDL

PSASDVKSPIIADLSLSLPSIPEVASDDERVDEVGDGGKAEKLVDLEAGVSPWNVSHSILETSGRSSGRAGESVPTENQCDFRPQVRSSENEELPGPGTV

EEEKLIGGEKPASPLCVSQDSSVPSPSVAETFPAAYSSPSSPPSDTHHTSEAESQKQATADVSTSRAENFGKKKPLLQAWVTPSEIHPTPALPSAGAGAA

KHR - UNI28353 - - UNI30018 - RPHPVKPMNTTATKIANSSLGTATIITENLISEALMK - UNI29135 - KYQPSDPAFAYAQLTHDEL

IQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEETPNILRVPAQMGKKAGKM

For any suggestions or comments, please send an email to unitrap@crg.es